Recombinant Full Length Human MPST Protein
Cat.No. : | MPST-311HF |
Product Overview : | Recombinant full length Human MPST (amino acids 1-297) with N terminal proprietary tag, 58.74 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 58.740kDa inclusive of tags |
Protein Length : | 297 amino acids |
AA Sequence : | MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPK LGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAE HFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF GHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDP AFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGI EPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWY MRARPEDVISEGRGKTH |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MPST mercaptopyruvate sulfurtransferase [ Homo sapiens (human) ] |
Official Symbol : | MPST |
Synonyms : | MPST; mercaptopyruvate sulfurtransferase; 3-mercaptopyruvate sulfurtransferase; human liver rhodanese; MST; TST2 |
Gene ID : | 4357 |
mRNA Refseq : | NM_001013436 |
Protein Refseq : | NP_001013454 |
MIM : | 602496 |
UniProt ID : | P25325 |
Products Types
◆ Recombinant Protein | ||
MPST-2637R | Recombinant Rhesus Macaque MPST Protein, His (Fc)-Avi-tagged | +Inquiry |
MPST-5520H | Recombinant Human MPST Protein, GST-tagged | +Inquiry |
MPST-3399R | Recombinant Rat MPST Protein, His (Fc)-Avi-tagged | +Inquiry |
Mpst-4129M | Recombinant Mouse Mpst Protein, Myc/DDK-tagged | +Inquiry |
MPST-7078H | Recombinant Human MPST, His-tagged | +Inquiry |
◆ Lysates | ||
MPST-4223HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
MPST-4224HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket