Recombinant Full Length Human MYL4 Protein

• Cat.No.: MYL4-323HF
• Product Overview: Recombinant full length Human MYL4 with an N terminal proprietary tag; Predicted MWt 47.41 kDa.

Specification

• Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 47.410kDa inclusive of tags
• Protein Length: 197 amino acids
• AA Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFD PKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGD VLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLA TLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: MYL4 myosin, light chain 4, alkali; atrial, embryonic [ Homo sapiens ]
• Official Symbol: MYL4
• Synonyms: MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957
• Gene ID: 4635
• mRNA Refseq: NM_001002841
• Protein Refseq: NP_001002841
• MIM: 160770
• UniProt ID: P12829