Recombinant Full Length Human MYOG Protein
Cat.No. : | MYOG-327HF |
Product Overview : | Recombinant full length Human Myogenin with N terminal proprietary tag, 50.75kDa. |
- Specification
- Gene Information
- Related Products
Description : | Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 50.750kDa inclusive of tags |
Protein Length : | 224 amino acids |
AA Sequence : | MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTEL TLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSV DRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPS ECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
Official Symbol : | MYOG |
Synonyms : | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3 |
Gene ID : | 4656 |
mRNA Refseq : | NM_002479 |
Protein Refseq : | NP_002470 |
MIM : | 159980 |
UniProt ID : | P15173 |
Products Types
◆ Recombinant Protein | ||
MYOG-5867M | Recombinant Mouse MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOG-5853H | Recombinant Human MYOG Protein, GST-tagged | +Inquiry |
MYOG-3566H | Recombinant Human MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
Myog-1810M | Recombinant Mouse Myog Protein, His&GST-tagged | +Inquiry |
MYOG-8637Z | Recombinant Zebrafish MYOG | +Inquiry |
◆ Lysates | ||
MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket