Recombinant Full Length Human NDUFA9 Protein
Cat.No. : | NDUFA9-334HF |
Product Overview : | Recombinant full length Human NDUFA9 with N terminal proprietary tag, 69.5kDa. |
- Specification
- Gene Information
- Related Products
Description : | The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 69.500kDa inclusive of tags |
Protein Length : | 377 amino acids |
AA Sequence : | MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHAL MPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQV IIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAG VEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAII VKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV YVVDVSKGIVNAVKD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | NDUFA9 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa [ Homo sapiens ] |
Official Symbol : | NDUFA9 |
Synonyms : | NDUFA9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD) , NDUFS2L; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial; CI 39k; complex I 39kDa subunit; SDR |
Gene ID : | 4704 |
mRNA Refseq : | NM_005002 |
Protein Refseq : | NP_004993 |
MIM : | 603834 |
UniProt ID : | Q16795 |
Products Types
◆ Recombinant Protein | ||
NDUFA9-5974M | Recombinant Mouse NDUFA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFA9-3595R | Recombinant Rat NDUFA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ndufa9-4333M | Recombinant Mouse Ndufa9 Protein, Myc/DDK-tagged | +Inquiry |
NDUFA9-130H | Recombinant Human NDUFA9 Protein, His-tagged | +Inquiry |
NDUFA9-1428C | Recombinant Chicken NDUFA9 | +Inquiry |
◆ Lysates | ||
NDUFA9-3914HCL | Recombinant Human NDUFA9 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket