Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human NDUFV2 Protein

Cat.No. : NDUFV2-333HF
Product Overview : Recombinant full length Human NDUFV2 with a N terminal proprietary tag; Predicted MWt 53.46 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes the 24 kDa subunit of complex I, and is involved in electron transfer. Mutations in this gene are implicated in Parkinsons disease, bipolar disorder, schizophrenia, and have been found in one case of early onset hypertrophic cardiomyopathy and encephalopathy. A non-transcribed pseudogene of this locus is found on chromosome 19.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 53.460kDa inclusive of tags
Protein Length : 249 amino acids
AA Sequence : MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFV HRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVL PVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKV GETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKD IEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG PGFGVQAGL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : NDUFV2 NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa [ Homo sapiens ]
Official Symbol : NDUFV2
Synonyms : NDUFV2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD); NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; CI 24k; complex I 24kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot
Gene ID : 4729
mRNA Refseq : NM_021074
Protein Refseq : NP_066552
MIM : 600532
UniProt ID : P19404

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends