Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human NFYB Protein

Cat.No. : NFYB-338HF
Product Overview : Recombinant full length Human NFYB with a N terminal proprietary tag; Predicted MWt 48.51 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 48.510kDa inclusive of tags
Protein Length : 207 amino acids
AA Sequence : MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMN DHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAK DAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDG LSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : NFYB nuclear transcription factor Y, beta [ Homo sapiens ]
Official Symbol : NFYB
Synonyms : NFYB; nuclear transcription factor Y, beta; nuclear transcription factor Y subunit beta; CBF A; HAP3; NFYB
Gene ID : 4801
mRNA Refseq : NM_006166
Protein Refseq : NP_006157
MIM : 189904
UniProt ID : P25208

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends