Recombinant Full Length Human NFYB Protein
Cat.No. : | NFYB-338HF |
Product Overview : | Recombinant full length Human NFYB with a N terminal proprietary tag; Predicted MWt 48.51 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 48.510kDa inclusive of tags |
Protein Length : | 207 amino acids |
AA Sequence : | MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMN DHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAK DAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDG LSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | NFYB nuclear transcription factor Y, beta [ Homo sapiens ] |
Official Symbol : | NFYB |
Synonyms : | NFYB; nuclear transcription factor Y, beta; nuclear transcription factor Y subunit beta; CBF A; HAP3; NFYB |
Gene ID : | 4801 |
mRNA Refseq : | NM_006166 |
Protein Refseq : | NP_006157 |
MIM : | 189904 |
UniProt ID : | P25208 |
Products Types
◆ Recombinant Protein | ||
NFYB-2134H | Recombinant Human NFYB Protein (1-207 aa), GST-tagged | +Inquiry |
NFYB-6046M | Recombinant Mouse NFYB Protein, His (Fc)-Avi-tagged | +Inquiry |
NFYB-224H | Recombinant Human NFYB Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
NFYB-2839R | Recombinant Rhesus Macaque NFYB Protein, His (Fc)-Avi-tagged | +Inquiry |
Nfyb-4402M | Recombinant Mouse Nfyb Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
NFYB-3839HCL | Recombinant Human NFYB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket