Recombinant Full Length Human NPPA Protein
Cat.No. : | NPPA-347HF |
Product Overview : | Recombinant full length Human ANP with N terminal proprietary tag; Predicted MWt 42.57 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 42.570kDa inclusive of tags |
Protein Length : | 153 amino acids |
AA Sequence : | MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDF KNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEV PPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDGIGAQSGLGCNSFRYRR |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | NPPA natriuretic peptide A [ Homo sapiens ] |
Official Symbol : | NPPA |
Synonyms : | NPPA; natriuretic peptide A; ANP, natriuretic peptide precursor A , PND; natriuretic peptides A |
Gene ID : | 4878 |
mRNA Refseq : | NM_006172 |
Protein Refseq : | NP_006163 |
MIM : | 108780 |
UniProt ID : | P01160 |
Products Types
◆ Recombinant Protein | ||
NPPA-6041H | Recombinant Human NPPA Protein, GST-tagged | +Inquiry |
Nppa-2212M | Recombinant Mouse Nppa protein(123-150aa), His-KSI-tagged | +Inquiry |
NPPA-6169M | Recombinant Mouse NPPA Protein, His (Fc)-Avi-tagged | +Inquiry |
NPPA-1850H | Recombinant Human NPPA Protein, His&GST-tagged | +Inquiry |
Nppa-387R | Recombinant Rat Nppa Protein, His-tagged | +Inquiry |
◆ Lysates | ||
NPPA-3735HCL | Recombinant Human NPPA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All NPPA Products
Required fields are marked with *
My Review for All NPPA Products
Required fields are marked with *
0
Inquiry Basket