| Description : |
The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. |
| Source : |
In Vitro Cell Free System |
| Species : |
Human |
| Form : |
Liquid |
| Molecular Mass : |
65.930kDa inclusive of tags |
| Protein Length : |
365 amino acids |
| AA Sequence : |
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMR EESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE EDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVK QICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGS DSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLT KLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDA SAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKI ANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMG SS |
| Purity : |
Proprietary Purification |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
