Recombinant Full Length Human PITX1 Protein
Cat.No. : | PITX1-372HF |
Product Overview : | Recombinant full length Human PITX1 with N terminal proprietary tag; Predicted MW 60.61kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 60.610kDa inclusive of tags |
Protein Length : | 314 amino acids |
AA Sequence : | MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPR EPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGA DDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE EIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGY VPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFT FFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNS SLASLRLKSKQHSSFGYGALQGPASGLNACQYNS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | PITX1 paired-like homeodomain 1 [ Homo sapiens ] |
Official Symbol : | PITX1 |
Synonyms : | PITX1; paired-like homeodomain 1; BFT, paired like homeodomain transcription factor 1; pituitary homeobox 1; POTX; PTX1 |
Gene ID : | 5307 |
mRNA Refseq : | NM_002653 |
Protein Refseq : | NP_002644 |
MIM : | 602149 |
UniProt ID : | P78337 |
Products Types
◆ Recombinant Protein | ||
PITX1-4136R | Recombinant Rat PITX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PITX1-6769M | Recombinant Mouse PITX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PITX1-0261H | Recombinant Human PITX1 Protein (Arg90-Gln152), N-SUMO-tagged | +Inquiry |
PITX1-29536TH | Recombinant Human PITX1 | +Inquiry |
PITX1-28302TH | Recombinant Human PITX1 | +Inquiry |
◆ Lysates | ||
PITX1-1358HCL | Recombinant Human PITX1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket