Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human RGS3 Protein

Cat.No. : RGS3-452HF
Product Overview : Recombinant full length Human RGS3 , containing an N-terminal proprietary tag; predicted MWt 47.23 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 47.230kDa inclusive of tags
Protein Length : 193 amino acids
AA Sequence : MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPG APPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAV FQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIF AEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKR IFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : RGS3 regulator of G-protein signaling 3 [ Homo sapiens ]
Official Symbol : RGS3
Synonyms : RGS3; regulator of G-protein signaling 3; regulator of G protein signalling 3; C2PA; FLJ20370; PDZ RGS3
Gene ID : 5998
mRNA Refseq : NM_017790
Protein Refseq : NP_060260
MIM : 602189
UniProt ID : P49796

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RGS3 Products

Required fields are marked with *

My Review for All RGS3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends