Recombinant Full Length Human RORB Protein
Cat.No. : | RORB-438HF |
Product Overview : | Recombinant full length Human ROR beta, isoform 1 (aa 1-459) with a N terminal proprietary tag: predicted molecular weight 76.56 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 76.560kDa inclusive of tags |
Protein Length : | 459 amino acids |
AA Sequence : | MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQN NASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAV KFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR VYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDS GQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNN GQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQ THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRI TGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLF EGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA LFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNH LDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNT LFPPLYKELFNPDCATGCK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | RORB RAR-related orphan receptor B [ Homo sapiens ] |
Official Symbol : | RORB |
Synonyms : | RORB; RAR-related orphan receptor B; nuclear receptor ROR-beta; NR1F2; ROR BETA; RZRB |
Gene ID : | 6096 |
mRNA Refseq : | NM_006914 |
Protein Refseq : | NP_008845 |
MIM : | 601972 |
UniProt ID : | Q92753 |
Products Types
◆ Recombinant Protein | ||
RORB-3773R | Recombinant Rhesus Macaque RORB Protein, His (Fc)-Avi-tagged | +Inquiry |
RORB-7707M | Recombinant Mouse RORB Protein, His (Fc)-Avi-tagged | +Inquiry |
Rorb-5575M | Recombinant Mouse Rorb Protein, Myc/DDK-tagged | +Inquiry |
RORB-2359H | Recombinant Human RORB, GST-tagged | +Inquiry |
RORB-2360H | Recombinant Human RORB protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
RORB-2246HCL | Recombinant Human RORB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RORB Products
Required fields are marked with *
My Review for All RORB Products
Required fields are marked with *
0
Inquiry Basket