Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human RPL13 Protein

Cat.No. : RPL13-453HF
Product Overview : Recombinant full length Human RPL13 with N-terminal proprietary tag. Predicted MW 49.32 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 49.320kDa inclusive of tags
Protein Length : 211 amino acids
AA Sequence : MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQ AKARHIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEE LRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEY RSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNV YKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAK EAAEQDVEKKK
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : RPL13 ribosomal protein L13 [ Homo sapiens ]
Official Symbol : RPL13
Synonyms : RPL13; ribosomal protein L13; 60S ribosomal protein L13; BBC1; D16S444E; L13
Gene ID : 6137
mRNA Refseq : NM_000977
Protein Refseq : NP_000968
MIM : 113703
UniProt ID : P26373

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RPL13 Products

Required fields are marked with *

My Review for All RPL13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends