Recombinant Full Length Human RTN1 Protein
Cat.No. : | RTN1-450HF |
Product Overview : | Recombinant full length Human Reticulon 1 Isoform 3 with an N-terminal proprietary tag; predicted MWt 48.99 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 48.990kDa inclusive of tags |
Protein Length : | 208 amino acids |
AA Sequence : | MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSF LLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLK ELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMA VVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI PGAKRHAE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | RTN1 reticulon 1 [ Homo sapiens ] |
Official Symbol : | RTN1 |
Synonyms : | RTN1; reticulon 1; neuroendocrine specific protein , NSP; reticulon-1 |
Gene ID : | 6252 |
mRNA Refseq : | NM_021136 |
Protein Refseq : | NP_066959 |
MIM : | 600865 |
UniProt ID : | Q16799 |
Products Types
◆ Recombinant Protein | ||
RTN1-157H | Recombinant Human RTN1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RTN1-1953H | Recombinant Human RTN1 Protein, MYC/DDK-tagged | +Inquiry |
RTN1-1925H | Recombinant Human RTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RTN1-4852R | Recombinant Rat RTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rtn1-246M | Recombinant Mouse Rtn1 Protein, MYC/DDK-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RTN1 Products
Required fields are marked with *
My Review for All RTN1 Products
Required fields are marked with *
0
Inquiry Basket