Recombinant Full Length Human SDHD Protein

• Cat.No.: SDHD-458HF
• Product Overview: Recombinant full length Human SDHD with a N terminal proprietary tag: predicted MW 43.56 kDa.

Specification

• Description: Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ.The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane.The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane.Mutations in SDHD have been linked to hereditary paraganglioma.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 43.560kDa inclusive of tags
• Protein Length: 159 amino acids
• AA Sequence: MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPI PEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLL PAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: SDHD succinate dehydrogenase complex, subunit D, integral membrane protein [ Homo sapiens ]
• Official Symbol: SDHD
• Synonyms: SDHD; succinate dehydrogenase complex, subunit D, integral membrane protein; PGL, PGL1; succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
• Gene ID: 6392
• mRNA Refseq: NM_003002
• Protein Refseq: NP_002993
• MIM: 602690
• UniProt ID: O14521