Recombinant Full Length Human SGCG Protein
Cat.No. : | SGCG-469HF |
Product Overview : | Recombinant full length Human gamma Sarcoglycan with N terminal proprietary tag; Predicted MWt 58.08 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 58.080kDa inclusive of tags |
Protein Length : | 291 amino acids |
AA Sequence : | MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFV LLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRL EGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEG EVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVV GTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS LSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAE TVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVS TTCQEHSHICL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SGCG sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) [ Homo sapiens ] |
Official Symbol : | SGCG |
Synonyms : | SGCG; sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein); DMDA1, LGMD2C, MAM, sarcoglycan, gamma (35kD dystrophin associated glycoprotein); gamma-sarcoglycan; 35kD dystrophin associated glycoprotein; A4; DAGA4; DMDA; gamma sarcoglycan; limb gi |
Gene ID : | 6445 |
mRNA Refseq : | NM_000231 |
Protein Refseq : | NP_000222 |
MIM : | 608896 |
UniProt ID : | Q13326 |
Products Types
◆ Recombinant Protein | ||
SGCG-8099M | Recombinant Mouse SGCG Protein, His (Fc)-Avi-tagged | +Inquiry |
Sgcg-5822M | Recombinant Mouse Sgcg Protein, Myc/DDK-tagged | +Inquiry |
SGCG-359H | Recombinant Human SGCG Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
SGCG-1996H | Recombinant Human SGCG Protein, His (Fc)-Avi-tagged | +Inquiry |
SGCG-28970TH | Recombinant Human SGCG | +Inquiry |
◆ Lysates | ||
SGCG-1887HCL | Recombinant Human SGCG 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket