Recombinant Full Length Human SNRPC Protein

• Cat.No.: SNRPC-486HF
• Product Overview: Recombinant full length Human SNRPC with N-terminal proprietary tag. Predicted MW 43.56 kDa.

Specification

• Description: This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 43.560kDa inclusive of tags
• Protein Length: 159 amino acids
• AA Sequence: MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQK WMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP PSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens ]
• Official Symbol: SNRPC
• Synonyms: SNRPC; small nuclear ribonucleoprotein polypeptide C; U1 small nuclear ribonucleoprotein C; U1 C; Yhc1
• Gene ID: 6631
• mRNA Refseq: NM_003093
• Protein Refseq: NP_003084
• MIM: 603522
• UniProt ID: P09234