Recombinant Full Length Human SSX1 Protein
Cat.No. : | SSX1-499HF |
Product Overview : | Recombinant full length Human SSX1 with N terminal proprietary tag; predicted MWt 46.5 kDa inclusive of tag; Q16384, |
- Specification
- Gene Information
- Related Products
Description : | The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 46.750kDa inclusive of tags |
Protein Length : | 188 amino acids |
AA Sequence : | MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKM KYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQ GNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE NDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRG KHAWTHRLRERKQLVIYEEISDPEEDDE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SSX1 synovial sarcoma, X breakpoint 1 [ Homo sapiens ] |
Official Symbol : | SSX1 |
Synonyms : | SSX1; synovial sarcoma, X breakpoint 1; protein SSX1; cancer/testis antigen family 5; member 1; CT5.1 |
Gene ID : | 6756 |
mRNA Refseq : | NM_005635 |
Protein Refseq : | NP_005626 |
MIM : | 312820 |
UniProt ID : | Q16384 |
Products Types
◆ Recombinant Protein | ||
SSX1-2108H | Recombinant Human SSX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSX1-021H | Recombinant Human SSX1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
SSX1-30141TH | Recombinant Human SSX1 | +Inquiry |
SSX1-31171TH | Recombinant Human SSX1 | +Inquiry |
SSX1-7541H | Recombinant Human SSX1, His-tagged | +Inquiry |
◆ Lysates | ||
SSX1-1450HCL | Recombinant Human SSX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket