Recombinant Full Length Human STX2 Protein
Cat.No. : | STX2-512HF |
Product Overview : | Recombinant full length Human Syntaxin 2 Isoform 1 with N-Terminal proprietary tag.Mol Wt 57.64 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 57.640kDa inclusive of tags |
Protein Length : | 287 amino acids |
AA Sequence : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIR NSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKE IKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTT DDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT DYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGI ILATTLS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | STX2 syntaxin 2 [ Homo sapiens ] |
Official Symbol : | STX2 |
Synonyms : | STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM |
Gene ID : | 2054 |
mRNA Refseq : | NM_001980 |
Protein Refseq : | NP_001971 |
MIM : | 132350 |
UniProt ID : | P32856 |
Products Types
◆ Recombinant Protein | ||
Stx2-961M | Recombinant Mouse Stx2 Protein, MYC/DDK-tagged | +Inquiry |
STX2-4046H | Recombinant Human STX2 Protein, GST-tagged | +Inquiry |
STX2-5472R | Recombinant Rat STX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
STX2-2990H | Recombinant Human STX2 Protein, MYC/DDK-tagged | +Inquiry |
STX2-5749H | Recombinant Human STX2 Protein (Met1-Arg188), N-His tagged | +Inquiry |
◆ Lysates | ||
STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket