Recombinant Full Length Human TACSTD2 Protein
Cat.No. : | TACSTD2-515HF |
Product Overview : | Recombinant full length Human TACD2 with N terminal proprietary tag, 58.78kDa. |
- Specification
- Gene Information
- Related Products
Description : | This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 58.780kDa inclusive of tags |
Protein Length : | 298 amino acids |
AA Sequence : | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDC STLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDP DCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCD ELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRL HPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYF ERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPP KFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKY KKVEIKELGELRKEPSL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ] |
Official Symbol : | TACSTD2 |
Synonyms : | TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2 |
Gene ID : | 4070 |
mRNA Refseq : | NM_002353 |
Protein Refseq : | NP_002344 |
MIM : | 137290 |
UniProt ID : | P09758 |
Products Types
◆ Recombinant Protein | ||
Tacstd2-6273M | Recombinant Mouse Tacstd2 Protein, Myc/DDK-tagged | +Inquiry |
TACSTD2-971R | Recombinant Rat TACSTD2 Protein (Met1-Gly270), His-tagged | +Inquiry |
TACSTD2-10H | Active Recombinant Human TACSTD2 Protein (His27-Thr274), C-6×His tagged | +Inquiry |
TACSTD2-2153H | Recombinant Human TACSTD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TACSTD2-5568R | Recombinant Rat TACSTD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket