Recombinant Full Length Human TCEB1 Protein
Cat.No. : | TCEB1-521HF |
Product Overview : | Recombinant full length Human TCEB1 with N terminal proprietary tag; Predicted MWt 38.06 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 38.060kDa inclusive of tags |
Protein Length : | 112 amino acids |
AA Sequence : | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSG TIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK VRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | TCEB1 transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) [ Homo sapiens ] |
Official Symbol : | TCEB1 |
Synonyms : | TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C); transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C); transcription elongation factor B polypeptide 1; SIII |
Gene ID : | 6921 |
mRNA Refseq : | NM_001204863 |
Protein Refseq : | NP_001191792 |
MIM : | 600788 |
UniProt ID : | Q15369 |
Products Types
◆ Recombinant Protein | ||
TCEB1-4467R | Recombinant Rhesus Macaque TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEB1-9074M | Recombinant Mouse TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEB1-5645R | Recombinant Rat TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEB1-4651R | Recombinant Rhesus monkey TCEB1 Protein, His-tagged | +Inquiry |
TCEB1-16550M | Recombinant Mouse TCEB1 Protein | +Inquiry |
◆ Lysates | ||
TCEB1-1189HCL | Recombinant Human TCEB1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket