Recombinant Full Length Human TOR1A Protein
Cat.No. : | TOR1A-528HF |
Product Overview : | Recombinant full length Human Torsin A with N-terminal proprietary tag.Mol Wt 62.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 62.630kDa inclusive of tags |
Protein Length : | 332 amino acids |
AA Sequence : | MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYP RLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKKIIL NAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIY EGGLNSDYVHLFVATLHFPHASNITLYKDQLQLWIRGNVS ACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQK AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHAL SVSVFNNKNSGFWHSSLIHRNLIDYFVPFLPLEYKHLKMC IRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCK TVFTKLDYYYDD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | TOR1A torsin family 1, member A (torsin A) [ Homo sapiens ] |
Official Symbol : | TOR1A |
Synonyms : | TOR1A; torsin family 1, member A (torsin A); dystonia 1, torsion (autosomal dominant; torsin A) , DYT1; torsin-1A; DQ2 |
Gene ID : | 1861 |
mRNA Refseq : | NM_000113 |
Protein Refseq : | NP_000104 |
MIM : | 605204 |
UniProt ID : | O14656 |
Products Types
◆ Recombinant Protein | ||
TOR1A-542H | Recombinant Human TOR1A Protein, His-tagged | +Inquiry |
Tor1a-6584M | Recombinant Mouse Tor1a Protein, Myc/DDK-tagged | +Inquiry |
TOR1A-786C | Recombinant Cynomolgus Monkey TOR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
Tor1a-543M | Recombinant Mouse Tor1a Protein, His-tagged | +Inquiry |
TOR1A-5728H | Recombinant Human TOR1A Protein (Val33-Ser250), N-His tagged | +Inquiry |
◆ Lysates | ||
TOR1A-866HCL | Recombinant Human TOR1A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TOR1A Products
Required fields are marked with *
My Review for All TOR1A Products
Required fields are marked with *
0
Inquiry Basket