Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ABCF3, His-tagged

Cat.No. : ABCF3-26042TH
Product Overview : Recombinant fragment, corresponding to amino acids 14-685 of Human ABCF3, with N terminal His tag, 672 amino acids, MWt 77.3kDa,
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : ABCF3 belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily. Contains 2 ABC transporter domains. There are 2 named isoforms produced by alternative splicing.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:reconstitution with 41 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSG DSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPI QLSKITENYDCGTKLPGLLKREQSSTVNAKKLEKAEARLK AKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLES SGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLV GRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDD TPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEA AELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPT REFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAI LWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLD GYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFI DRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKFP DGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLES RICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKI GYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRY GISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILD EPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCR ELWVCEGGGV
Gene Name : ABCF3 ATP-binding cassette, sub-family F (GCN20), member 3 [ Homo sapiens ]
Official Symbol : ABCF3
Synonyms : ABCF3; ATP-binding cassette, sub-family F (GCN20), member 3; ATP-binding cassette sub-family F member 3; EST201864;
Gene ID : 55324
mRNA Refseq : NM_018358
Protein Refseq : NP_060828
Uniprot ID : Q9NUQ8
Chromosome Location : 3q25.1-q25.2
Function : ATP binding; ATPase activity; nucleotide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (20)

Ask a question
What is the cellular function of ABCF3 and in which cellular processes does it participate 09/22/2022

The cellular function of ABCF3, also known as ABC50 (ATP-binding cassette subfamily F member 3), is primarily related to its role as an ATP-binding cassette (ABC) transporter. It is involved in the transport of molecules across cellular membranes, facilitating the efflux of substrates from cells.

Does ABCF3 exhibit any tissue-specific expression patterns or differential expression in different cell types? 06/19/2022

ABCF3 is believed to be expressed in various tissues and cell types, suggesting a broad expression profile.

Are there any known regulatory mechanisms controlling ABCF3's expression and activity? 03/20/2022

Transcriptional regulation, post-translational modifications, or interactions with other proteins may influence ABCF3 function.

Does ABCF3 play a role in drug resistance or multidrug resistance in cancer cells? 07/24/2021

ABCF3 has been implicated in drug resistance or multidrug resistance in cancer cells. It is believed to contribute to the efflux of chemotherapeutic drugs from cancer cells, reducing their effectiveness and contributing to drug resistance.

Are there any known diseases or conditions where ABCF3 dysregulation has been implicated? 07/12/2021

While specific disease associations with ABCF3 are not widely reported, dysregulation of ABC transporters, including those in the F subfamily, has been implicated in drug resistance in cancer cells and certain genetic disorders

What are the structural features or domains of ABCF3 that are essential for its transport activity? 01/25/2021

As an ATP-binding cassette (ABC) transporter, ABCF3 likely possesses the characteristic ABC domains responsible for ATP binding and hydrolysis, as well as transmembrane domains that form the transport channel.

What family does ABCF3 belongs to? 01/14/2021

ATP-binding cassette subfamily F member 3 (ABCF3) belongs to a member of the ATP-binding cassette (ABC) transporter superfamily.

What is the fucntion of ABCF3 protein? 12/22/2020

It displays an antiviral effect against flaviviruses such as west Nile virus (WNV) in the presence of OAS1B.

Does ABCF3 have any regulatory roles in cellular processes beyond its function as a transporter? 04/11/2020

ABCF3 may be involved in cellular signaling pathways or contribute to cellular homeostasis through its transport activity. 

 Are there any known substrates or specific classes of molecules that are transported by ABCF3? 04/11/2020

TRI27 and FCSD2 has binary interactions with ABCF3

Are there any known cellular or physiological conditions that result in altered ABCF3 expression or activity? 10/15/2019

Conditions involving altered cellular transport processes, drug response, or cellular homeostasis could potentially be associated with ABCF3 dysregulation.

What is the subcellular localization of ABCF3 and are there any mechanisms that regulate its localization? 08/05/2019

ABCF3 is primarily localized to the plasma membrane, but it may also be found in intracellular organelles involved in transport, such as the endoplasmic reticulum.

Does ABCF3 protein has any caution when believed involved in transport? 06/02/2019

It lacks transmembrane domains and is probably not involved in transport.

what is the cellular localization of ABCF3 protein? 12/02/2017

ABCF3 is primarily localized to the plasma membrane, but it may also be found in intracellular organelles involved in transport processes, such as the endoplasmic reticulum.

Are there any known regulatory mechanisms that control the expression or activity of ABCF3? 11/22/2017

Factors such as transcriptional regulation, post-translational modifications, or protein-protein interact

Are there any known physiological or pathological roles of ABCF3 beyond drug resistance in cancer cells? 05/25/2017

Given its involvement in cellular transport processes, it is possible that ABCF3 may have implications in cellular metabolism, cellular signaling, or other cellular functions.

Are there any genetic variations or mutations in the ABCF3 gene that have been associated with specific diseases or conditions? 03/12/2017

Variations or dysregulation of ABCF3 expression could potentially influence drug response or alter cellular transport processes

Which species are the portein of ABCF3 present in? 01/17/2017

ABCF3 are mainly present in species of human, mouse, rat, slime mold and A.thaliana.

Does ABCF3 play a role in the transport of specific classes of molecules, such as lipids, nucleotides, or peptides? 08/20/2016

While ABC transporters can transport a wide range of substrates, including lipids, nucleotides, peptides, and drugs, further research is needed to identify the precise substrates and their functional relevance for ABCF3.

Are there any structural domains or motifs within the ABCF3 protein that are critical for its function? 05/09/2016

ABCF3 consists of two transmembrane domains (TMDs) that form the transport channel across the cell membrane and two nucleotide-binding domains (NBDs) responsible for ATP binding and hydrolysis.

Customer Reviews (5)

Write a review
Reviews
04/17/2020

    I appreciated that the protein did not cause any irritation or adverse effects on my skin during handling.

    11/02/2019

      The ABCF3 product exhibited excellent activity.

      12/05/2018

        The protein product's reliability and consistent results justified the investment for my long-term experiments.

        02/12/2018

          They promptly addressed my inquiries and providing helpful guidance throughout the ordering process.

          11/03/2017

            I received excellent technical support from the company

            Ask a Question for All ABCF3 Products

            Required fields are marked with *

            My Review for All ABCF3 Products

            Required fields are marked with *

            0

            Inquiry Basket

            cartIcon
            logo

            FOLLOW US

            Terms and Conditions        Privacy Policy

            Copyright © 2024 Creative BioMart. All Rights Reserved.

            Contact Us

            • /

            Stay Updated on the Latest Bioscience Trends