Recombinant Human ABCF3, His-tagged
Cat.No. : | ABCF3-26042TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 14-685 of Human ABCF3, with N terminal His tag, 672 amino acids, MWt 77.3kDa, |
- Specification
- Gene Information
- Related Products
- Download
Description : | ABCF3 belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily. Contains 2 ABC transporter domains. There are 2 named isoforms produced by alternative splicing. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 41 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSG DSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPI QLSKITENYDCGTKLPGLLKREQSSTVNAKKLEKAEARLK AKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLES SGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLV GRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDD TPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEA AELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPT REFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAI LWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLD GYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFI DRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKFP DGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLES RICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKI GYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRY GISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILD EPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCR ELWVCEGGGV |
Gene Name : | ABCF3 ATP-binding cassette, sub-family F (GCN20), member 3 [ Homo sapiens ] |
Official Symbol : | ABCF3 |
Synonyms : | ABCF3; ATP-binding cassette, sub-family F (GCN20), member 3; ATP-binding cassette sub-family F member 3; EST201864; |
Gene ID : | 55324 |
mRNA Refseq : | NM_018358 |
Protein Refseq : | NP_060828 |
Uniprot ID : | Q9NUQ8 |
Chromosome Location : | 3q25.1-q25.2 |
Function : | ATP binding; ATPase activity; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
ABCF3-246H | Recombinant Human ABCF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCF3-206M | Recombinant Mouse ABCF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Abcf3-1464M | Recombinant Mouse Abcf3 Protein, Myc/DDK-tagged | +Inquiry |
ABCF3-68R | Recombinant Rat ABCF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCF3-062H | Recombinant Human ABCF3 Protein, GST-Tagged | +Inquiry |
◆ Lysates | ||
ABCF3-9143HCL | Recombinant Human ABCF3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (20)
Ask a questionThe cellular function of ABCF3, also known as ABC50 (ATP-binding cassette subfamily F member 3), is primarily related to its role as an ATP-binding cassette (ABC) transporter. It is involved in the transport of molecules across cellular membranes, facilitating the efflux of substrates from cells.
ABCF3 is believed to be expressed in various tissues and cell types, suggesting a broad expression profile.
Transcriptional regulation, post-translational modifications, or interactions with other proteins may influence ABCF3 function.
ABCF3 has been implicated in drug resistance or multidrug resistance in cancer cells. It is believed to contribute to the efflux of chemotherapeutic drugs from cancer cells, reducing their effectiveness and contributing to drug resistance.
While specific disease associations with ABCF3 are not widely reported, dysregulation of ABC transporters, including those in the F subfamily, has been implicated in drug resistance in cancer cells and certain genetic disorders
As an ATP-binding cassette (ABC) transporter, ABCF3 likely possesses the characteristic ABC domains responsible for ATP binding and hydrolysis, as well as transmembrane domains that form the transport channel.
ATP-binding cassette subfamily F member 3 (ABCF3) belongs to a member of the ATP-binding cassette (ABC) transporter superfamily.
It displays an antiviral effect against flaviviruses such as west Nile virus (WNV) in the presence of OAS1B.
ABCF3 may be involved in cellular signaling pathways or contribute to cellular homeostasis through its transport activity.
TRI27 and FCSD2 has binary interactions with ABCF3
Conditions involving altered cellular transport processes, drug response, or cellular homeostasis could potentially be associated with ABCF3 dysregulation.
ABCF3 is primarily localized to the plasma membrane, but it may also be found in intracellular organelles involved in transport, such as the endoplasmic reticulum.
It lacks transmembrane domains and is probably not involved in transport.
ABCF3 is primarily localized to the plasma membrane, but it may also be found in intracellular organelles involved in transport processes, such as the endoplasmic reticulum.
Factors such as transcriptional regulation, post-translational modifications, or protein-protein interact
Given its involvement in cellular transport processes, it is possible that ABCF3 may have implications in cellular metabolism, cellular signaling, or other cellular functions.
Variations or dysregulation of ABCF3 expression could potentially influence drug response or alter cellular transport processes
ABCF3 are mainly present in species of human, mouse, rat, slime mold and A.thaliana.
While ABC transporters can transport a wide range of substrates, including lipids, nucleotides, peptides, and drugs, further research is needed to identify the precise substrates and their functional relevance for ABCF3.
ABCF3 consists of two transmembrane domains (TMDs) that form the transport channel across the cell membrane and two nucleotide-binding domains (NBDs) responsible for ATP binding and hydrolysis.
Customer Reviews (5)
Write a reviewI appreciated that the protein did not cause any irritation or adverse effects on my skin during handling.
The ABCF3 product exhibited excellent activity.
The protein product's reliability and consistent results justified the investment for my long-term experiments.
They promptly addressed my inquiries and providing helpful guidance throughout the ordering process.
I received excellent technical support from the company
Ask a Question for All ABCF3 Products
Required fields are marked with *
My Review for All ABCF3 Products
Required fields are marked with *
Inquiry Basket