Recombinant Human ABLIM1
Cat.No. : | ABLIM1-26043TH |
Product Overview : | Recombinant full length Human ABLIM1 isoform 4 with a N terminal proprietary tag; Predicted MW 70.18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Protein length : | 401 amino acids |
Molecular Weight : | 70.180kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Detected in liver, heart, skeletal muscle, brain and retina, where it is concentrated in the inner segment and in the outer plexiform layers. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILD YKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQS LGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYS RHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQ SKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAV VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQL ILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLP GYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMP AMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDR TRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKL F |
Sequence Similarities : | Contains 1 HP (headpiece) domain.Contains 4 LIM zinc-binding domains. |
Gene Name : | ABLIM1 actin binding LIM protein 1 [ Homo sapiens ] |
Official Symbol : | ABLIM1 |
Synonyms : | ABLIM1; actin binding LIM protein 1; ABLIM, LIMAB1; actin-binding LIM protein 1; abLIM; limatin; |
Gene ID : | 3983 |
mRNA Refseq : | NM_001003407 |
Protein Refseq : | NP_001003407 |
MIM : | 602330 |
Uniprot ID : | O14639 |
Chromosome Location : | 10q25 |
Pathway : | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function : | actin binding; metal ion binding; protein binding; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
ABLIM1-223M | Recombinant Mouse ABLIM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABLIM1-1143M | Recombinant Mouse ABLIM1 Protein | +Inquiry |
ABLIM1-108H | Recombinant Human ABLIM1 Protein, GST-Tagged | +Inquiry |
ABLIM1-3942C | Recombinant Chicken ABLIM1 | +Inquiry |
ABLIM1-107H | Recombinant Human ABLIM1 Protein, GST-Tagged | +Inquiry |
◆ Lysates | ||
ABLIM1-9125HCL | Recombinant Human ABLIM1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionUpon delivery aliquot and store at -80 centigrade. Avoid freeze/thaw cycles.
ABLIM-1 was originally found in human retina as well as in the sarcomeres of murine cardiac tissue and was postulated to regulate actin-dependent signaling.
Yes.ABLIM1 has been shown to interact with LDOC1.
We will remove endotoxin according to customer's requirements and verify by LAL method.
All of our products can be customized, and protein products of different purity can be delivered according to different needs of customers.
ABLIM1 localization in cytoplasm and cytoskeleton.
ABLIM1 may act as scaffold protein. It may play a role in the retina development and in axon guidance.
yes, it is.
Among its related pathways are Nervous system development and Netrin-1 signaling.
Diseases associated with ABLIM1 include Spermatogenic Failure, Y-Linked, 2
Customer Reviews (2)
Write a reviewcost-effective and high-quality.
The product quality is very good. Online consulting service can help you quickly find your target, very efficient.
Ask a Question for All ABLIM1 Products
Required fields are marked with *
My Review for All ABLIM1 Products
Required fields are marked with *
Inquiry Basket