Recombinant Human ABLIM1

• Cat.No.: ABLIM1-26043TH
• Product Overview: Recombinant full length Human ABLIM1 isoform 4 with a N terminal proprietary tag; Predicted MW 70.18 kDa.

Specification

• Description: This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Protein length: 401 amino acids
• Molecular Weight: 70.180kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Detected in liver, heart, skeletal muscle, brain and retina, where it is concentrated in the inner segment and in the outer plexiform layers.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILD YKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQS LGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYS RHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQ SKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAV VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQL ILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLP GYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMP AMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDR TRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKL F
• Sequence Similarities: Contains 1 HP (headpiece) domain.Contains 4 LIM zinc-binding domains.

Gene Information

• Gene Name: ABLIM1 actin binding LIM protein 1 [ Homo sapiens ]
• Official Symbol: ABLIM1
• Synonyms: ABLIM1; actin binding LIM protein 1; ABLIM, LIMAB1; actin-binding LIM protein 1; abLIM; limatin
• Gene ID: 3983
• mRNA Refseq: NM_001003407
• Protein Refseq: NP_001003407
• MIM: 602330
• Uniprot ID: O14639
• Chromosome Location: 10q25
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem
• Function: actin binding; metal ion binding; protein binding; zinc ion binding

Reviews

01/21/2022

cost-effective and high-quality.

10/10/2020

The product quality is very good. Online consulting service can help you quickly find your target, very efficient.

Q&As

How to store the product after receiving it?

Upon delivery aliquot and store at -80 centigrade. Avoid freeze/thaw cycles.

Where was ABLIM1 first discovered?

ABLIM-1 was originally found in human retina as well as in the sarcomeres of murine cardiac tissue and was postulated to regulate actin-dependent signaling.

Will there be an interaction between LDOC1 and ABLIM1?

Yes.ABLIM1 has been shown to interact with LDOC1.

Does the endotoxin in your product meet the requirements?

We will remove endotoxin according to customer's requirements and verify by LAL method.

What is the purity of the product ABLIM1-03HF?

All of our products can be customized, and protein products of different purity can be delivered according to different needs of customers.

Where is ABLIM1 localized?

ABLIM1 localization in cytoplasm and cytoskeleton.

What are the functions of ABLIM1?

ABLIM1 may act as scaffold protein. It may play a role in the retina development and in axon guidance.

Is ABLIM3 a paralog of ABLIM1?

yes, it is.

Which cellular pathways are involved in Actin Binding LIM Protein 1?

Among its related pathways are Nervous system development and Netrin-1 signaling.

Which diseases are associated with ABLIM1?

Diseases associated with ABLIM1 include Spermatogenic Failure, Y-Linked, 2