Recombinant Human ACP1, His-tagged
Cat.No. : | ACP1-26291TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 4-158 of Human Acid Phosphatase with a N terminal His tag; 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 114 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVD SAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKE DFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGS YDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
Gene Name : | ACP1 acid phosphatase 1, soluble [ Homo sapiens ] |
Official Symbol : | ACP1 |
Synonyms : | ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase; |
Gene ID : | 52 |
mRNA Refseq : | NM_001040649 |
Protein Refseq : | NP_001035739 |
MIM : | 171500 |
Uniprot ID : | P24666 |
Chromosome Location : | 2p25 |
Pathway : | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; EPHA2 forward signaling, organism-specific biosystem; PDGFR-beta signaling pathway, organism-specific biosystem; Riboflavin metabolism, organism-specific biosystem; |
Function : | acid phosphatase activity; hydrolase activity; non-membrane spanning protein tyrosine phosphatase activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
Acp1-45M | Recombinant Mouse Acp1 Protein, His-tagged | +Inquiry |
Acp1-44M | Recombinant Mouse Acp1 Protein, His-tagged | +Inquiry |
Acp1-514M | Recombinant Mouse Acp1 Protein, MYC/DDK-tagged | +Inquiry |
ACP1-1146H | Recombinant Human ACP1 protein(Met1-His158), GST-tagged | +Inquiry |
Acp1-5710R | Recombinant Rat Acp1 protein, His-tagged | +Inquiry |
◆ Lysates | ||
ACP1-9083HCL | Recombinant Human ACP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionF and S.
Through the polymerase chain reaction-resreiction fragment length polymorphism.
Esophageal cancer, gastric cancer and gastrointestinal cancer will lead to up-regulation of ACP1 expression, while colorectal cancer will reduce it.
Because ACP1 has low dephosphorylation effect on insulin receptor.
To adjust the level of FMN and flavin adenine dinucleotide.
Immunohistochemical staining observation of two related protein sections.
Three.
The cholesterol biosynthesis, neutotransmitter synthesis and it links to behavioral and cellular response to stress via p190RhoGAP
The PBS conraining 10% goat serum.
The TPH2, DDC and GAD1.
Customer Reviews (3)
Write a reviewThe answers are very concise.
There are all the questions I want to know.
The answer was very patient.
Ask a Question for All ACP1 Products
Required fields are marked with *
My Review for All ACP1 Products
Required fields are marked with *
Inquiry Basket