Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ACP1, His-tagged

Cat.No. : ACP1-26291TH
Product Overview : Recombinant fragment, corresponding to amino acids 4-158 of Human Acid Phosphatase with a N terminal His tag; 21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 114 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVD SAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKE DFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGS YDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Gene Name : ACP1 acid phosphatase 1, soluble [ Homo sapiens ]
Official Symbol : ACP1
Synonyms : ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase;
Gene ID : 52
mRNA Refseq : NM_001040649
Protein Refseq : NP_001035739
MIM : 171500
Uniprot ID : P24666
Chromosome Location : 2p25
Pathway : Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; EPHA2 forward signaling, organism-specific biosystem; PDGFR-beta signaling pathway, organism-specific biosystem; Riboflavin metabolism, organism-specific biosystem;
Function : acid phosphatase activity; hydrolase activity; non-membrane spanning protein tyrosine phosphatase activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
What are the two subtypes of ACP1? 02/14/2023

F and S.

How to analyze ACP1 polymorphism? 02/14/2023

Through the polymerase chain reaction-resreiction fragment length polymorphism.

What disease would be influenced by ABHD14A? 02/13/2023

Esophageal cancer, gastric cancer and gastrointestinal cancer will lead to up-regulation of ACP1 expression, while colorectal cancer will reduce it.

Why is the blood glucose level of inactive ACP1 A low? 02/11/2023

Because ACP1 has low dephosphorylation effect on insulin receptor.

How ACP1 works on respiration and cell oxidation? 02/10/2023

To adjust the level of FMN and flavin adenine dinucleotide.

How to detect the protein level of ACP1? 02/08/2023

Immunohistochemical staining observation of two related protein sections.

How many codominant alleles are there in ACP1? 02/08/2023

Three.

What activities may ACP1 participate in the brain? 02/07/2023

The cholesterol biosynthesis, neutotransmitter synthesis and it links to behavioral and cellular response to stress via p190RhoGAP

What's the ACP1 blocking buffer? 02/05/2023

The PBS conraining 10% goat serum.

What protein is significantly associated with ACP1 in the brain? 02/05/2023

The TPH2, DDC and GAD1.

Customer Reviews (3)

Write a review
Reviews
02/17/2023

    The answers are very concise.

    02/16/2023

      There are all the questions I want to know.

      02/16/2023

        The answer was very patient.

        Ask a Question for All ACP1 Products

        Required fields are marked with *

        My Review for All ACP1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends