Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ACTL6B protein, GST-tagged

Cat.No. : ACTL6B-301380H
Product Overview : Recombinant Human ACTL6B (40-82 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length : Thr40-Met82
AA Sequence : TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name : ACTL6B actin-like 6B [ Homo sapiens ]
Official Symbol : ACTL6B
Synonyms : ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; arpNalpha; hArpN alpha; actin-like 6; BRG1-associated factor 53B; actin-related protein Baf53b; 53 kDa BRG1-associated factor B; ACTL6;
Gene ID : 51412
mRNA Refseq : NM_016188
Protein Refseq : NP_057272
MIM : 612458
UniProt ID : O94805

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (21)

Ask a question
Does ACTL6B have any known interacting partners outside the nBAF complex? 08/28/2022

While the main known interacting partners of ACTL6B are within the nBAF complex, additional interactions with other proteins or complexes have not been extensively characterized.

Is ACTL6B involved in any developmental processes? 06/30/2022

Yes, ACTL6B is implicated in neuronal development and differentiation, as it is required for proper chromatin remodeling during neuronal maturation.

What is the evolutionary conservation of ACTL6B? 06/25/2022

ACTL6B is evolutionarily conserved across different species, indicating its functional importance throughout evolution.

Are there any alternative splicing variants of ACTL6B? 02/09/2022

Alternative splicing variants of ACTL6B have not been widely reported in the literature. The majority of studies focus on the canonical isoform of ACTL6B.

Are there any known post-translational modifications of ACTL6B? 12/22/2021

Specific post-translational modifications of ACTL6B, such as phosphorylation or acetylation, have not been extensively studied.

What is the role of ACTL6B in recessive autism spectrum disorder (ASD)? 11/05/2021

ACTL6B loss is a significant cause of recessive ASD, suggesting its involvement in the development of this disorder.

What are the cellular functions of ACTL6B? 08/28/2021

ACTL6B plays a role in chromatin remodeling, gene regulation, and transcriptional control in various cell types, particularly in postmitotic neurons.

Is ACTL6B structurally similar to other actin-like proteins? 05/17/2021

Yes, ACTL6B shares structural similarities with other actin-like proteins, including the presence of an actin fold and conserved residues involved in protein-protein interactions.

What is the subcellular localization of ACTL6B? 03/24/2021

ACTL6B is primarily localized in the nucleus, where it exerts its functions in chromatin remodeling and gene regulation.

What are the functional roles of ACTL6B in cells? 04/15/2020

ACTL6B, as part of the nBAF complex, is involved in chromatin remodeling and gene regulation, particularly in postmitotic neurons. It plays a role in shaping the chromatin landscape and influencing cellular processes related to neuronal development and function.

What is the family of ACTL6B? 03/14/2020

ACTL6B belongs to the actin-like protein family, which comprises proteins that share structural similarities with actin but may have distinct functions and roles in cellular processes.

Are there any known homologs or paralogs of ACTL6B? 03/04/2020

Yes, ACTL6B has a paralog called ACTL6A (Actin-like 6A), which shares similarities in structure and function.

Are there any known genetic disorders associated with ACTL6B mutations? 05/15/2019

Currently, there are no specific genetic disorders linked to ACTL6B mutations

How does the nBAF complex contribute to chromatin remodeling? 04/02/2019

The nBAF complex, including ACTL6B, plays a role in modifying the structure of chromatin, allowing for proper gene regulation and functional changes in postmitotic neurons.

Which complex is ACTL6B a part of, and what is its function in neurons? 12/08/2018

ACTL6B is a component of the neuronal BRG1/brm-associated factor (nBAF) complex, which is required for chromatin remodeling specifically in postmitotic neurons.

 Can ACTL6B interact with other proteins or complexes? 09/13/2018

Yes, ACTL6B interacts with other proteins within the neuronal BRG1/brm-associated factor (nBAF) complex, including various subunits involved in chromatin remodeling and gene regulation.

Does ACTL6B have any known interacting partners outside the nBAF complex? 09/05/2018

While the main known interacting partners of ACTL6B are within the nBAF complex, additional interactions with other proteins or complexes have not been extensively characterized.

Are there potential implications for targeting ACTL6B or the nBAF complex in ASD treatment? 06/26/2018

Targeting ACTL6B or the nBAF complex could hold therapeutic potential for ASD; however, further research is needed to understand the precise mechanisms involved and to evaluate the feasibility and effectiveness of such targeting approaches.

 Is ACTL6B expressed in specific tissues or cell types? 05/01/2018

ACTL6B is widely expressed in various tissues, but its expression is particularly prominent in the brain, where it plays a crucial role in neuronal development and function.

What is the proposed mechanism by which ACTL6B contributes to ASD? 12/30/2017

Impaired neuron-specific chromatin repression is proposed as a potential mechanism underlying the association between ACTL6B loss and ASD.

What is the structure of ACTL6B? 05/29/2017

ACTL6B belongs to the actin-like protein family and has a conserved structure similar to actin proteins. It consists of a globular domain and a flexible C-terminal tail.

Customer Reviews (5)

Write a review
Reviews
06/29/2020

    Increased protein expression, enhanced cell proliferation, or inhibition of specific biological processes, when using this protein.

    02/08/2020

      The packaging includes proper labeling and documentation, facilitating easy identification and handling of the protein product upon arrival.

      10/07/2019

        They have provided valuable technical guidance and troubleshooting assistance, helping us optimize our experimental protocols and achieve better results.

        01/08/2018

          We have successfully replicated our findings using multiple batches of the protein product, indicating its reliable and consistent behavior.

          01/28/2017

            The protein product is produced using state-of-the-art manufacturing techniques, ensuring consistent quality and performance.

            Ask a Question for All ACTL6B Products

            Required fields are marked with *

            My Review for All ACTL6B Products

            Required fields are marked with *

            0

            Inquiry Basket

            cartIcon
            logo

            FOLLOW US

            Terms and Conditions        Privacy Policy

            Copyright © 2024 Creative BioMart. All Rights Reserved.

            Contact Us

            • /

            Stay Updated on the Latest Bioscience Trends