Recombinant Human ACTR1B, His-tagged
Cat.No. : | ACTR1B-26592TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-376 of Human ACTR1B with N terminal His tag, 46kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVG RPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHG VVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLN PSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYL RLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDE ALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDES EGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGF GDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILA SLDTFKKMWVSKKEYEEDGSRAIHRKTF |
Sequence Similarities : | Belongs to the actin family. ARP1 subfamily. |
Gene Name : | ACTR1B ARP1 actin-related protein 1 homolog B, centractin beta (yeast) [ Homo sapiens ] |
Official Symbol : | ACTR1B |
Synonyms : | ACTR1B; ARP1 actin-related protein 1 homolog B, centractin beta (yeast); ARP1 (actin related protein 1, yeast) homolog B (centractin beta) , CTRN2; beta-centractin; |
Gene ID : | 10120 |
mRNA Refseq : | NM_005735 |
Protein Refseq : | NP_005726 |
MIM : | 605144 |
Uniprot ID : | P42025 |
Chromosome Location : | 2q11.1-q11.2 |
Function : | ATP binding; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
ACTR1B-55R | Recombinant Rhesus Macaque ACTR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTR1B-371H | Recombinant Human ACTR1B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACTR1B-293M | Recombinant Mouse ACTR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
Actr1b-1518M | Recombinant Mouse Actr1b Protein, Myc/DDK-tagged | +Inquiry |
ACTR1B-235H | Recombinant Human ACTR1B Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
ACTR1B-9052HCL | Recombinant Human ACTR1B 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All ACTR1B Products
Required fields are marked with *
My Review for All ACTR1B Products
Required fields are marked with *
0
Inquiry Basket