Recombinant Human ADD2
Cat.No. : | ADD2-26138TH |
Product Overview : | Recombinant full length Human Adducin 2 with a N terminal proprietary tag; Predicted MW 105.93 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described. |
Protein length : | 726 amino acids |
Molecular Weight : | 105.930kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed mainly in brain, spleen, kidney cortex and medulla, and heart. Also expressed in human umbilical vein endothelial cells, human vascular smooth muscle cells, kidney tubular cells and K562 cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAAD LRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNN SSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHT ADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLR VSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSS CFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMK WGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGP TCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSAL SSAGGVENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRL GEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEI PATVTAFVFEEDGAPVPALRQHAQKQQKEKTRWLNTPNAY LRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIE NPNQFVPLYTDPQEVLEMRNKIREQNRQDVKSAGPQSQLL ASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQL TDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPAS PVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPE TTQPEGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTS KDKTESVTSGPMSPEGSPSKSPSKKKKKFRTPSFLKKSKK KEKVES |
Sequence Similarities : | Belongs to the aldolase class II family. Adducin subfamily. |
Gene Name : | ADD2 adducin 2 (beta) [ Homo sapiens ] |
Official Symbol : | ADD2 |
Synonyms : | ADD2; adducin 2 (beta); beta-adducin; ADDB; |
Gene ID : | 119 |
mRNA Refseq : | NM_001185054 |
Protein Refseq : | NP_001171983 |
MIM : | 102681 |
Uniprot ID : | P35612 |
Chromosome Location : | 2p13.3 |
Function : | actin binding; actin filament binding; calmodulin binding; metal ion binding; protein heterodimerization activity; |
Products Types
◆ Recombinant Protein | ||
ADD2-71R | Recombinant Rhesus Macaque ADD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADD2-340M | Recombinant Mouse ADD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Add2-540M | Recombinant Mouse Add2 Protein, MYC/DDK-tagged | +Inquiry |
ADD2-1351M | Recombinant Mouse ADD2 Protein | +Inquiry |
ADD2-243R | Recombinant Rhesus monkey ADD2 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
ADD2-9016HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
ADD2-9015HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionThere may exist small molecules or drugs that selectively modulate the activity or stability of ADD2.
ADD2 interacts with specific proteins or binding partners, and these interactions can be context-dependent.
The expression profile of ADD2 varies across different tissues and cell types.
ADD2 regulates downstream signaling pathways or target molecules that contribute to its cellular functions.
Specific antibodies or probes can be developed to visualize the localization or dynamics of ADD2 in live cells or tissues.
Post-translational modifications, such as phosphorylation or ubiquitination, occur on ADD2 and can influence its function.
Functional domains or motifs within ADD2 can be identified and characterized.
The expression of ADD2 can be regulated during development or in response to specific stimuli.
Modulating the expression or activity of ADD2 can impact cellular processes like cytoskeletal organization, cell motility, or membrane dynamics.
ADD2 exhibits subcellular localization, and its localization may undergo dynamic changes or translocation.
Customer Reviews (2)
Write a reviewHighly sensitive in bioactivity assays, accurately detecting the activity and concentration of bioactive factors.
Provides accurate and reliable quantification of protein biomarkers in clinical samples.
Ask a Question for All ADD2 Products
Required fields are marked with *
My Review for All ADD2 Products
Required fields are marked with *
Inquiry Basket