Recombinant Human ADM
Cat.No. : | ADM-27104TH |
Product Overview : | Recombinant fragment of Human Adrenomedullin with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKA GPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNN FQGLRSFGCRFGTCTVQKLAHQIYQFTDKD |
Sequence Similarities : | Belongs to the adrenomedullin family. |
Gene Name : | ADM adrenomedullin [ Homo sapiens ] |
Official Symbol : | ADM |
Synonyms : | ADM; adrenomedullin; AM; |
Gene ID : | 133 |
mRNA Refseq : | NM_001124 |
Protein Refseq : | NP_001115 |
MIM : | 103275 |
Uniprot ID : | P35318 |
Chromosome Location : | 11 |
Pathway : | Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
Function : | adrenomedullin receptor binding; hormone activity; receptor binding; |
Products Types
◆ Recombinant Protein | ||
ADM-7324H | Recombinant Human ADM protein(Tyr95-Tyr146), hFc-tagged | +Inquiry |
Adm-545M | Recombinant Mouse Adm Protein, MYC/DDK-tagged | +Inquiry |
ADM-1361H | Recombinant Human ADM Protein, MYC/DDK-tagged | +Inquiry |
ADM-351M | Recombinant Mouse ADM Protein, His (Fc)-Avi-tagged | +Inquiry |
ADM-85H | Recombinant Human ADM Protein, His&SUMO-tagged | +Inquiry |
◆ Lysates | ||
ADM-1530HCL | Recombinant Human ADM cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (14)
Ask a questionADM proteins have been studied for potential therapies for Alzheimer's disease because they promote the growth and survival of neurons. ADM has been shown to enhance cognitive function and reduce inflammation in animal models of Alzheimer's disease. ADM agonists, which mimic the activity of ADM, are being studied as potential therapies for Alzheimer's disease.
ADM proteins have been studied as a potential biomarker for cardiovascular disease. High levels of ADM have been associated with an increased risk of cardiovascular disease, and measuring ADM levels in the blood may help identify patients at risk. However, further research is needed to determine the usefulness of ADM as a biomarker for cardiovascular disease.
There are several methods for measuring ADM proteins in medical tests, including immunoassays, enzyme-linked immunosorbent assays (ELISAs), and radioimmunoassays (RIAs). These tests are typically performed on blood or urine samples. The levels of ADM proteins in these samples can be used to diagnose and monitor various medical conditions.
ADM proteins have multiple functions in the human body. They are involved in the regulation of blood pressure, cardiovascular function, angiogenesis, endothelial cell proliferation, and immune response. They also play a role in the development of various diseases, including cardiovascular disease, cancer, and inflammatory disorders.
Abnormal levels of ADM proteins are associated with various medical conditions. Low levels of ADM proteins have been implicated in cardiovascular disease, sepsis, and inflammatory disorders. High levels of ADM proteins have been associated with pulmonary hypertension, kidney disease, and certain types of cancer.
Yes, ADM proteins are a potential target for medical treatment. There are several drugs currently in development that target ADM activity, including ADM receptor antagonists and ADM-specific antibodies. These treatments may be useful for a variety of conditions, including cardiovascular disease, sepsis, and cancer.
ADM proteins can interact with the immune system in several ways. ADM has been shown to have immunomodulatory effects, which means it can influence the activity of immune cells. ADM can inhibit the activity of inflammatory cells and decrease the production of pro-inflammatory cytokines. ADM has also been shown to have a chemotactic effect on immune cells, which means it can attract immune cells to sites of inflammation or infection.
There are several lifestyle changes that can affect ADM protein levels in the body. For example, exercise has been shown to increase ADM levels, while smoking has been shown to decrease ADM levels. Diet may also play a role in ADM protein levels, with some studies suggesting that a high-fat diet may decrease ADM levels. Patients should talk to their healthcare providers about lifestyle changes that may be beneficial for their specific conditions.
Yes, ADM protein levels tend to increase with age. This may be due to changes in cardiovascular function and endothelial cell function that occur with aging. Elevated ADM levels have been associated with age-related diseases such as hypertension and atherosclerosis.
ADM proteins are being studied for potential cancer treatments because they play a role in tumor growth and vascularization. ADM proteins promote angiogenesis, which is the process of forming new blood vessels, and can contribute to tumor growth and metastasis. Targeting ADM signaling may be a way to inhibit tumor growth and improve the effectiveness of current cancer therapies.
ADM proteins have been studied as a potential treatment for sepsis, a life-threatening condition that occurs when the body's immune response to infection becomes dysregulated. ADM has anti-inflammatory and vasodilatory effects, which may help mitigate the effects of sepsis. ADM infusion has been shown to improve survival rates in animal models of sepsis, and clinical trials are ongoing to determine if ADM can be used as a treatment for sepsis in humans.
There are currently no FDA-approved drugs that target ADM signaling. However, drugs that target ADM signaling are being studied in clinical trials for a variety of conditions, including sepsis, heart failure, and cancer. These drugs include ADM receptor agonists, which mimic the activity of ADM, and ADM-neutralizing antibodies, which block the activity of ADM.
There are generally no known risks associated with measuring ADM protein levels in medical tests. However, as with any medical test, there is a small risk of complications from the sample collection process, such as infection or bleeding. Patients should discuss any concerns they have about medical tests with their healthcare providers.
ADM protein levels have been studied as a potential predictor of mortality in critically ill patients. High levels of ADM have been associated with an increased risk of death in patients with sepsis, heart failure, and other critical illnesses. Measuring ADM levels may help identify patients who are at high risk of mortality and may benefit from early interventions and aggressive treatment.
Customer Reviews (4)
Write a reviewThe manufacturer has also provided me with technical support that is second to none, helping me troubleshoot any problems that I faced.
I also appreciate the outstanding technical support offered by the manufacturer, which has saved me a lot of time and effort in troubleshooting my experiments.
The manufacturer has earned my trust with their excellent technical support, which has been instrumental in simplifying my experiments and minimizing the margin of error.
The protein I have decided on is of top-notch quality, showing high activity and reliability in my experiments.
Ask a Question for All ADM Products
Required fields are marked with *
My Review for All ADM Products
Required fields are marked with *
Inquiry Basket