Recombinant Human ADORA3

• Cat.No.: ADORA3-26898TH
• Product Overview: Recombinant fragment corresponding to amino acids 121-225 of Human Adenosine A3 Receptor with N terminal proprietary tag; predicted MW: 37.18 kDa, inclusive of tag. P33765, AAH29831.

Specification

• Description: This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Multiple transcript variants encoding different isoforms have been found for this gene.
• Protein length: 105 amino acids
• Molecular Weight: 37.180kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRN VTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDI FYIIRNKLSLNLSNSKETGAFYGRE
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: ADORA3 adenosine A3 receptor [ Homo sapiens ]
• Official Symbol: ADORA3
• Synonyms: ADORA3; adenosine A3 receptor; adenosine receptor A3; AD026
• Gene ID: 140
• mRNA Refseq: NM_000677
• Protein Refseq: NP_000668
• MIM: 600445
• Uniprot ID: P33765
• Chromosome Location: 1p21-p13
• Pathway: Adenosine P1 receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem
• Function: G-protein coupled adenosine receptor activity; receptor activity; signal transducer activity

Reviews

06/01/2021

Its excellent solubility and stability properties have given me confidence in its reliability.

10/17/2018

The purity and consistency of this protein have surpassed my expectations, making it an ideal choice for my research.

06/18/2018

the technical team has been extremely responsive and knowledgeable, offering valuable insights and solutions to any concerns I had.

Q&As

Are there any drugs currently on the market that target ADORA3 proteins?

There are currently no drugs available that specifically target ADORA3 proteins. However, there are drugs that target other adenosine receptors, such as caffeine (which blocks adenosine receptors), methylxanthines (which block both adenosine A1 and A2A receptors), and antiarrhythmic drugs (which target adenosine A1 receptors in the heart).

What are ADORA3 proteins?

ADORA3 proteins, also known as adenosine A3 receptors, are a subtype of adenosine receptors that are found in various tissues throughout the body including the brain, heart, lungs, liver, and immune cells. These receptors are responsible for mediating the effects of adenosine, a signaling molecule that regulates various physiological processes including inflammation, immune function, and cardiovascular function.

What are some challenges associated with developing drugs that target ADORA3 proteins?

One challenge is the potential for side effects, as these receptors are found in multiple tissues throughout the body and have diverse effects on various physiological processes. Therefore, drugs targeting ADORA3 proteins may have off-target effects on other tissues and systems. Additionally, ADORA3-targeting drugs may need to be developed with specific dosing strategies or combinations with other medications to be effective against certain diseases.