Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human AFF2

Cat.No. : AFF2-26444TH
Product Overview : Recombinant fragment of Human AFF2 with N terminal proprietary tag. Predicted MW 37.84 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. Alternate splicing results in multiple transcript variants.
Protein length : 111 amino acids
Molecular Weight : 37.840kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Brain (most abundant in hippocampus and amygdala), placenta and lung.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTL IHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQ SQAKLEDFFVYPAEQPQIGEVEESNPSAKED
Sequence Similarities : Belongs to the AF4 family.
Gene Name : AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ]
Official Symbol : AFF2
Synonyms : AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE;
Gene ID : 2334
mRNA Refseq : NM_001169122
Protein Refseq : NP_001162593
MIM : 300806
Uniprot ID : P51816
Chromosome Location : Xq28
Function : G-quadruplex RNA binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
How is the expression of AFF2 protein regulated, and what factors or signaling pathways control its expression? 01/06/2023

The expression of AFF2 protein is regulated by specific factors and signaling pathways.

Are there any genetic variations or mutations in the gene encoding AFF2 protein that impact its expression or function, and what are the implications for neuronal processes or disease susceptibility? 01/10/2022

Genetic variations or mutations in the gene encoding AFF2 protein may impact its expression or function, influencing neuronal processes or disease susceptibility.

Can AFF2 protein be targeted or manipulated to modulate neuronal function or treat neurological disorders, and what are the potential implications for therapeutic interventions? 10/21/2021

AFF2 protein holds potential as a target for modulating neuronal function or treating neurological disorders, and further research is needed to explore its implications for therapeutic interventions.

How does dysregulation or dysfunction of AFF2 protein affect neuronal homeostasis, synaptic plasticity, or neurological disorders? 06/15/2020

Dysregulation or dysfunction of AFF2 protein can disrupt neuronal homeostasis, impair synaptic plasticity, and contribute to neurological disorders.

How does AFF2 protein contribute to gene expression regulation or chromatin organization, and what are the underlying molecular mechanisms? 05/11/2020

AFF2 protein contributes to gene expression regulation or chromatin organization, and the underlying molecular mechanisms are currently being investigated.

Are there any known post-translational modifications or regulatory mechanisms that modulate the activity or stability of AFF2 protein? 10/17/2018

Post-translational modifications and regulatory mechanisms may modulate the activity or stability of AFF2 protein.

What experimental techniques or assays have been used to study the functional significance of AFF2 protein, such as immunoprecipitation, electrophysiology, or animal models? 09/03/2018

Various experimental techniques or assays, such as immunoprecipitation, electrophysiology, or animal models, have been used to study the functional significance of AFF2 protein.

What is the subcellular localization of AFF2 protein, and how can it be experimentally determined? 07/18/2018

The subcellular localization of AFF2 protein can be experimentally determined using techniques such as immunofluorescence microscopy or subcellular fractionation.

Does AFF2 protein interact with specific molecules or participate in protein complexes, and what are the functional implications of these interactions? 10/29/2016

AFF2 protein may interact with specific molecules or participate in protein complexes, which have functional implications in cellular processes.

What is the role of AFF2 protein in neuronal development, synaptic function, or neurological disorders, and how can its function be investigated experimentally? 05/04/2016

AFF2 protein plays a role in neuronal development, synaptic function, or neurological disorders, and its function can be investigated using techniques like gene knockdown or overexpression studies.

Customer Reviews (3)

Write a review
Reviews
03/30/2019

    Deciphering protein-protein interactions in neurodevelopmental disorders for therapeutic targets.

    12/17/2017

      Dissecting protein-protein interactions in autophagy flux for cellular clearance.

      11/07/2017

        Probing protein-protein interactions in lipid signaling for metabolic regulation.

        Ask a Question for All AFF2 Products

        Required fields are marked with *

        My Review for All AFF2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends