Recombinant Human AFF2
Cat.No. : | AFF2-26444TH |
Product Overview : | Recombinant fragment of Human AFF2 with N terminal proprietary tag. Predicted MW 37.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. Alternate splicing results in multiple transcript variants. |
Protein length : | 111 amino acids |
Molecular Weight : | 37.840kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Brain (most abundant in hippocampus and amygdala), placenta and lung. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTL IHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQ SQAKLEDFFVYPAEQPQIGEVEESNPSAKED |
Sequence Similarities : | Belongs to the AF4 family. |
Gene Name : | AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ] |
Official Symbol : | AFF2 |
Synonyms : | AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE; |
Gene ID : | 2334 |
mRNA Refseq : | NM_001169122 |
Protein Refseq : | NP_001162593 |
MIM : | 300806 |
Uniprot ID : | P51816 |
Chromosome Location : | Xq28 |
Function : | G-quadruplex RNA binding; |
Products Types
◆ Recombinant Protein | ||
AFF2-375M | Recombinant Mouse AFF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AFF2-1399M | Recombinant Mouse AFF2 Protein | +Inquiry |
Aff2-3231M | Recombinant Mouse Aff2, His-tagged | +Inquiry |
AFF2-406H | Recombinant Human AFF2 Protein, GST-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionThe expression of AFF2 protein is regulated by specific factors and signaling pathways.
Genetic variations or mutations in the gene encoding AFF2 protein may impact its expression or function, influencing neuronal processes or disease susceptibility.
AFF2 protein holds potential as a target for modulating neuronal function or treating neurological disorders, and further research is needed to explore its implications for therapeutic interventions.
Dysregulation or dysfunction of AFF2 protein can disrupt neuronal homeostasis, impair synaptic plasticity, and contribute to neurological disorders.
AFF2 protein contributes to gene expression regulation or chromatin organization, and the underlying molecular mechanisms are currently being investigated.
Post-translational modifications and regulatory mechanisms may modulate the activity or stability of AFF2 protein.
Various experimental techniques or assays, such as immunoprecipitation, electrophysiology, or animal models, have been used to study the functional significance of AFF2 protein.
The subcellular localization of AFF2 protein can be experimentally determined using techniques such as immunofluorescence microscopy or subcellular fractionation.
AFF2 protein may interact with specific molecules or participate in protein complexes, which have functional implications in cellular processes.
AFF2 protein plays a role in neuronal development, synaptic function, or neurological disorders, and its function can be investigated using techniques like gene knockdown or overexpression studies.
Customer Reviews (3)
Write a reviewDeciphering protein-protein interactions in neurodevelopmental disorders for therapeutic targets.
Dissecting protein-protein interactions in autophagy flux for cellular clearance.
Probing protein-protein interactions in lipid signaling for metabolic regulation.
Ask a Question for All AFF2 Products
Required fields are marked with *
My Review for All AFF2 Products
Required fields are marked with *
Inquiry Basket