Recombinant Human AFG3L2, His-tagged
Cat.No. : | AFG3L2-26445TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 5-169 of Human AFG3L2 with an N terminal His tag. Predicted MWt: 19 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVT TQARASRNSLLTDIIAAYQRFCSRPPKGFGKYFPNGKN GKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGG KKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGRE |
Gene Name : | AFG3L2 AFG3 ATPase family gene 3-like 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol : | AFG3L2 |
Synonyms : | AFG3L2; AFG3 ATPase family gene 3-like 2 (S. cerevisiae); AFG3 (ATPase family gene 3, yeast) like 2 , AFG3 ATPase family gene 3 like 2 (yeast) , SCA28, spinocerebellar ataxia 28; AFG3-like protein 2; |
Gene ID : | 10939 |
mRNA Refseq : | NM_006796 |
Protein Refseq : | NP_006787 |
MIM : | 604581 |
Uniprot ID : | Q9Y4W6 |
Chromosome Location : | 18p11.21 |
Function : | ATP binding; metal ion binding; metalloendopeptidase activity; nucleoside-triphosphatase activity; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
AFG3L2-376M | Recombinant Mouse AFG3L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AFG3L2-9459H | Recombinant Human AFG3L2, His-tagged | +Inquiry |
AFG3L2-1401M | Recombinant Mouse AFG3L2 Protein | +Inquiry |
AFG3L2-5205H | Recombinant Human AFG3L2 protein, GST-tagged | +Inquiry |
AFG3L2-409H | Recombinant Human AFG3L2 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
AFG3L2-8987HCL | Recombinant Human AFG3L2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionAFG3L2 protein contributes to mitochondrial dynamics, proteostasis, or mitochondrial DNA maintenance, and the underlying molecular mechanisms are currently being investigated.
The subcellular localization of AFG3L2 protein can be experimentally determined using techniques such as immunofluorescence microscopy or subcellular fractionation.
Genetic variations or mutations in the gene encoding AFG3L2 protein may impact its expression or function, influencing mitochondrial dysfunction or neurodegenerative diseases.
Various experimental techniques or assays, such as electron microscopy, protein degradation assays, or animal models, have been used to study the functional significance of AFG3L2 protein.
Dysregulation or dysfunction of AFG3L2 protein can disrupt mitochondrial homeostasis, impair cellular energetics, and contribute to neurodegenerative disease progression.
AFG3L2 protein may interact with specific molecules or participate in protein complexes, which have functional implications in cellular processes.
AFG3L2 protein plays a role in mitochondrial function, protein quality control, or neurodegenerative diseases, and its function can be investigated using techniques like electron microscopy, protein degradation assays, or animal models.
AFG3L2 protein holds potential as a target for modulating mitochondrial function or treating neurodegenerative disorders, and further research is needed to explore its implications for therapeutic interventions.
The expression of AFG3L2 protein is regulated by specific factors and signaling pathways.
Post-translational modifications and regulatory mechanisms may modulate the activity or stability of AFG3L2 protein.
Customer Reviews (3)
Write a reviewDeciphering protein-protein interactions in stem cell differentiation for cellular fate determination.
Exploring protein-protein interactions in RNA metabolism for gene expression regulation.
Elucidating protein-protein interactions in neuronal plasticity for learning and memory.
Ask a Question for All AFG3L2 Products
Required fields are marked with *
My Review for All AFG3L2 Products
Required fields are marked with *
Inquiry Basket