Recombinant Human AFM
Cat.No. : | AFM-26448TH |
Product Overview : | Recombinant full length Human AFM with N-terminal proprietary tag. Predicted MW 96.1kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. The protein encoded by this gene is regulated developmentally, expressed in the liver and secreted into the bloodstream. |
Protein length : | 599 amino acids |
Molecular Weight : | 96.100kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKLLKLTGFIFFLFFLTESLTLPTQPRDIENFNSTQKFIE DNIEYITIIAFAQYVQEATFEEMEKLVKDMVEYKDRCM ADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVD AQRRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRE SLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCE EQNKVNCLQTRAIPVTQYLKAFSSYQKHVCGALLKFGTKV VHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEG DVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPER GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTF FAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTE NPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDG LKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSE EFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFA FRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEE LQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCK AESPEVCFNEESPKIGN |
Sequence Similarities : | Belongs to the ALB/AFP/VDB family.Contains 3 albumin domains. |
Gene Name : | AFM afamin [ Homo sapiens ] |
Official Symbol : | AFM |
Synonyms : | AFM; afamin; ALB2; ALBA; |
Gene ID : | 173 |
mRNA Refseq : | NM_001133 |
Protein Refseq : | NP_001124 |
MIM : | 104145 |
Uniprot ID : | P43652 |
Chromosome Location : | 4q13.3 |
Function : | vitamin E binding; |
Products Types
◆ Recombinant Protein | ||
AFM-1087H | Recombinant Human AFM protein(Met1-Asn599), His-tagged | +Inquiry |
Afm-499M | Recombinant Mouse Afm Protein, His-tagged | +Inquiry |
Afm-91R | Recombinant Rat Afm Protein, His-tagged | +Inquiry |
AFM-497H | Recombinant Human AFM Protein, His-tagged | +Inquiry |
AFM-377M | Recombinant Mouse AFM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
AFM-794HCL | Recombinant Human AFM cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionAFM protein plays a role in cellular processes such as cell adhesion, migration, or signaling pathways, and the underlying molecular mechanisms can be investigated using techniques like siRNA knockdown, gene overexpression, or functional assays.
Post-translational modifications or regulatory mechanisms may modulate the activity or function of AFM protein, and these can be studied through site-directed mutagenesis, phosphoproteomics analysis, or biochemical assays.
Downstream signaling pathways or cellular responses triggered by AFM protein activation can be studied through techniques such as Western blotting, gene expression analysis, or functional assays specific to the signaling pathways of interest.
The cellular localization of AFM protein can be experimentally determined using techniques such as immunofluorescence microscopy or subcellular fractionation.
The role of AFM protein in tissue development, organogenesis, or disease progression can be explored using model systems such as animal models, organoid cultures, or tissue engineering approaches.
The binding partners or interacting molecules of AFM protein can be identified through approaches like co-immunoprecipitation, protein-protein interaction assays, or mass spectrometry.
Modulating AFM protein activity or expression may have implications for cell behavior or tissue regeneration, and the therapeutic potential can be assessed using in vitro or in vivo models combined with functional assays or tissue engineering approaches.
Genetic variations or mutations in the gene encoding AFM protein may impact its expression or function, leading to altered cellular phenotypes or disease susceptibility, and these can be investigated through genetic association studies or functional characterization of mutant variants.
AFM protein influences cellular biomechanics, and its effects on cell stiffness, contractility, or cytoskeletal organization can be investigated through techniques like atomic force microscopy, traction force microscopy, or cytoskeletal staining.
Dysregulation or dysfunction of AFM protein contributes to pathologies or disease conditions, and associations can be investigated using disease models, patient samples, or genetically modified systems, combined with phenotypic assessments or molecular analysis techniques.
Customer Reviews (3)
Write a reviewProbing protein-protein interactions in chromatin modifications for gene regulation.
Deciphering protein-protein interactions in mitochondrial function for cellular energy production.
Studying protein-protein interactions in apoptosis pathways for programmed cell death.
Ask a Question for All AFM Products
Required fields are marked with *
My Review for All AFM Products
Required fields are marked with *
Inquiry Basket