Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human AGAP1, His-tagged

Cat.No. : AGAP1-26447TH
Product Overview : Recombinant fragment, corresponding to amino acids 675-804 of Human AGAP1 with N terminal His tag; 130 amino acids, 18kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEG DGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTA LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRN NNRNNSSGRVPTII
Sequence Similarities : Belongs to the centaurin gamma-like family.Contains 2 ANK repeats.Contains 1 Arf-GAP domain.Contains 1 PH domain.
Gene Name : AGAP1 ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
Official Symbol : AGAP1
Synonyms : AGAP1; ArfGAP with GTPase domain, ankyrin repeat and PH domain 1; centaurin, gamma 2 , CENTG2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1; GGAP1; KIAA1099;
Gene ID : 116987
mRNA Refseq : NM_014914
Protein Refseq : NP_055729
MIM : 608651
Uniprot ID : Q9UPQ3
Chromosome Location : 2q37
Pathway : Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function : ARF GTPase activator activity; GTP binding; metal ion binding; nucleotide binding; zinc ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (20)

Ask a question
How does AGAP1 work? 10/08/2022

AGAP1 helps in the inactivation of Arf1 by accelerating its GTP hydrolysis, which is crucial for controlling vesicle trafficking between different cellular compartments.

Are there any drugs targeting AGAP1? 07/05/2022

Currently, there are no widely known drugs specifically targeting AGAP1, but research in this area could have therapeutic implications.

What is AGAP1 protein? 07/03/2022

AGAP1 (Arf-GAP with GTPase, Ankyrin repeat, and PH domain 1) is a protein involved in regulating cellular processes like vesicle trafficking and membrane dynamics.

How is AGAP1 linked to neurological disorders? 06/05/2022

AGAP1 mutations have been associated with certain neurological conditions, potentially affecting neuronal development and function.

How does AGAP1's function compare to other Arf-GAP proteins? 05/11/2022

AGAP1 is one of several Arf-GAP proteins, each with distinct roles in cellular processes and vesicle trafficking pathways.

How is AGAP1 involved in signal transduction? 01/15/2022

AGAP1 interacts with certain signaling molecules and receptors, influencing the transduction of signals within the cell.

What is the significance of AGAP1's ankyrin repeat domain? 08/05/2020

The ankyrin repeat domain likely enables AGAP1 to interact with other proteins, contributing to its functional versatility.

Are there any diseases associated with AGAP1? 02/09/2020

AGAP1 has been linked to certain neurological disorders and cancers, but its precise roles in these contexts are still being investigated.

Can AGAP1's functions be studied through genetic manipulation? 01/09/2020

Yes, researchers often use techniques like gene knockdown or overexpression to study AGAP1's effects on cellular processes.

What is the function of AGAP1? 12/24/2019

AGAP1 functions as a GTPase-activating protein (GAP) for the small GTPase Arf1, contributing to the regulation of membrane traffic and cellular signaling.

Is AGAP1's activity regulated by cellular conditions? 09/23/2019

Yes, AGAP1's activity can be influenced by factors like cell stress, changes in membrane composition, and intracellular signaling.

Can you provide an overview of AGAP1's cellular importance? 09/04/2019

AGAP1's functions are critical for maintaining proper cellular organization, membrane trafficking, and signal transduction, making it an important player in overall cell health.

What is the role of AGAP1 in membrane trafficking? 07/22/2019

AGAP1 helps regulate the formation and trafficking of vesicles between different cellular compartments, aiding in the proper distribution of cellular components.

Are there any known binding partners of AGAP1? 03/13/2019

AGAP1 interacts with Arf1, as well as other proteins involved in vesicle trafficking and membrane dynamics.

What other domains are present in AGAP1? 12/08/2018

AGAP1 contains ankyrin repeat and PH (pleckstrin homology) domains, which are involved in protein-protein and protein-lipid interactions, respectively.

Where is AGAP1 found? 06/27/2018

AGAP1 is found within cells, specifically in the cytoplasm and associated with membranes.

Is AGAP1's expression limited to specific cell types? 08/11/2017

AGAP1 is expressed in various cell types, but its levels may vary depending on the tissue and cell context.

What role does AGAP1 play in cellular processes? 10/03/2016

AGAP1 participates in processes like endocytosis, exocytosis, and maintenance of cellular membrane integrity.

What does AGAP1 stand for? 09/21/2016

AGAP1 stands for Arf-GAP with GTPase, Ankyrin repeat, and PH domain 1.

How is AGAP1's activity regulated? 01/03/2016

AGAP1's activity can be modulated by post-translational modifications, interactions with other proteins, and its localization within the cell.

Customer Reviews (5)

Write a review
Reviews
12/31/2021

    Protein's purity was evident in reproducible gel electrophoresis bands.

    11/12/2017

       The product’s cost-effectiveness and clear instructions facilitated seamless incorporation into our work.

      10/15/2017

        The insights gained from the protein product justified its cost, offering value for money.

        12/10/2016

          It facilitated efficient DNA binding in all tested experimental conditions.

          04/14/2016

             Despite its cost, the product’s contributions to our research goals rendered it an invaluable asset.

            Ask a Question for All AGAP1 Products

            Required fields are marked with *

            My Review for All AGAP1 Products

            Required fields are marked with *

            0

            Inquiry Basket

            cartIcon
            logo

            FOLLOW US

            Terms and Conditions        Privacy Policy

            Copyright © 2024 Creative BioMart. All Rights Reserved.

            Contact Us

            • /

            Stay Updated on the Latest Bioscience Trends