Recombinant Human AKR1B10
Cat.No. : | AKR1B10-27154TH |
Product Overview : | Recombinant full length Human AKR1B10 protein , 36 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. |
Protein length : | 316 amino acids |
Molecular Weight : | 36.000kDa |
Source : | E. coli |
Tissue specificity : | Found in many tissues. Highly expressed in small intestine, colon and adrenal gland. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGY RHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSKLW PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVS NFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYC HSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAEY |
Sequence Similarities : | Belongs to the aldo/keto reductase family. |
Gene Name : | AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) [ Homo sapiens ] |
Official Symbol : | AKR1B10 |
Synonyms : | AKR1B10; aldo-keto reductase family 1, member B10 (aldose reductase); AKR1B11; aldo-keto reductase family 1 member B10; AKR1B12; aldo keto reductase family 1; member B11 (aldose reductase like); aldose reductase like 1; aldose reductase like peptide; aldo |
Gene ID : | 57016 |
mRNA Refseq : | NM_020299 |
Protein Refseq : | NP_064695 |
MIM : | 604707 |
Uniprot ID : | O60218 |
Chromosome Location : | 7q33 |
Pathway : | Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Linoleic acid metabolism, organism-specific biosystem; |
Function : | aldo-keto reductase (NADP) activity; oxidoreductase activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
AKR1B10-0254H | Recombinant Human AKR1B10 Protein (M1-Y316), Tag Free | +Inquiry |
AKR1B10-0255H | Recombinant Human AKR1B10 Protein (M1-Y316), His tagged | +Inquiry |
AKR1B10-1533H | Recombinant Human AKR1B10 protein, His & T7-tagged | +Inquiry |
AKR1B10-406H | Active Recombinant Human AKR1B10 protein | +Inquiry |
AKR1B10-301110H | Recombinant Human AKR1B10 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
AKR1B10-8931HCL | Recombinant Human AKR1B10 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (15)
Ask a questionAKR1B10 protein is mainly detected in laboratory by enzyme-linked immunosorbent assay, fluorescence quantitative PCR and other methods.
AKR1B10 is involved in a variety of cell signaling pathways, such as NF-κB, WNT/ β-catenin signaling pathways, and thus plays a role in cell proliferation, differentiation and apoptosis.
This protein is involved in the NADP/NADPH metabolic pathway, plays an antioxidant and neuroprotective role, and thus has a promising application in the prevention and treatment of central nervous system diseases.
AKR1B10 has a certain application prospect in the early diagnosis and prognosis evaluation of lung cancer, colorectal cancer, liver cancer and other cancers.
The AKR1B10 protein is an alcohol contraction enzyme that is associated with a variety of diseases and is mainly found in tissues such as liver, lung, stomach, breast, kidney, pancreas and intestine.
AKR1B10 inhibitors can be used to prevent and treat a variety of inflammatory diseases, such as rheumatoid arthritis and hepatitis B.
AKR1B10 protein is associated with cell proliferation, angiogenesis and malignant metastasis in lung cancer
AKR1B10 inhibitors have potential anti-tumor and anti-inflammatory therapeutic effects and can be used in the treatment of lung cancer, breast cancer, diabetes and other diseases.
The expression level of AKR1B10 protein in tumor cells is increased, which is related to tumor proliferation, invasion and metastasis, and is a new tumor biomarker.
AKR1B10 is involved in the occurrence and development of metabolic diseases, such as diabetes and obesity, and is a possible therapeutic target.
AKR1B10 protein is involved in various metabolic processes and cell proliferation and growth, such as steroid hormone metabolism, fatty acid synthesis, cell cycle regulation and so on.
The metabolic pathways of steroid hormones involved in AKR1B10 include oxidative metabolism and reductive metabolism of steroid hormones.
AKR1B10 protein is involved in the metabolism of some drugs and may be related to hepatotoxicity, which is a hot molecule in the study of drug metabolism and toxicity.
AKR1B10 protein is associated with a variety of diseases, such as tumors, lung diseases, metabolic diseases, and neurological diseases.
AKR1B10 protein is involved in the metabolism of retinal glycoglycation end products, which is associated with diabetic retinopathy and other diseases.
Customer Reviews (4)
Write a reviewHas therapeutic effects on specific disease models and is a promising candidate for new drugs.
The laboratory personnel feedback that the protein is easy to operate, can meet the experimental needs, and has a good cost performance.
It has been found to increase yield and purity and improve production efficiency in biotechnology production.
Good fluorescence labeling performance in light microscopy technology, which is helpful for cell imaging studies.
Ask a Question for All AKR1B10 Products
Required fields are marked with *
My Review for All AKR1B10 Products
Required fields are marked with *
Inquiry Basket