Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ALAD, His-tagged

Cat.No. : ALAD-26880TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-226 of Human ALAD with N terminal His tag; MWt 26kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 109 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDV PDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLI FGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLL VACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVA LAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVM SYSAKFASCFYGPFRDAAKSSPAFGDRRCYQL
Gene Name : ALAD aminolevulinate dehydratase [ Homo sapiens ]
Official Symbol : ALAD
Synonyms : ALAD; aminolevulinate dehydratase; aminolevulinate, delta , dehydratase; delta-aminolevulinic acid dehydratase; ALADH; PBGS; porphobilinogen synthase;
Gene ID : 210
mRNA Refseq : NM_000031
Protein Refseq : NP_000022
MIM : 125270
Uniprot ID : P13716
Chromosome Location : 9q32
Pathway : Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of porphyrins, organism-specific biosystem;
Function : catalytic activity; identical protein binding; lead ion binding; lyase activity; porphobilinogen synthase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All ALAD Products

Required fields are marked with *

My Review for All ALAD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends