Recombinant Human ALDOA, His-tagged
Cat.No. : | ALDOA-26500TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-364 of Human Aldolase with an N-terminal His tag; Predicted MWt 40kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 71 μl aqua dest |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSI AKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI LFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPL AGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI GEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPN MVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITF LSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQA SALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPS GQAGAAASESLFVSNHAY |
Gene Name : | ALDOA aldolase A, fructose-bisphosphate [ Homo sapiens ] |
Official Symbol : | ALDOA |
Synonyms : | ALDOA; aldolase A, fructose-bisphosphate; fructose-bisphosphate aldolase A; |
Gene ID : | 226 |
mRNA Refseq : | NM_000034 |
Protein Refseq : | NP_000025 |
MIM : | 103850 |
Uniprot ID : | P04075 |
Chromosome Location : | 16p11.2 |
Pathway : | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; |
Function : | actin binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; identical protein binding; |
Products Types
◆ Recombinant Protein | ||
ALDOA-281R | Recombinant Rat ALDOA Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDOA-316H | Recombinant Human ALDOA Protein, His (Fc)-Avi-tagged | +Inquiry |
Aldoa-573M | Recombinant Mouse Aldoa Protein, MYC/DDK-tagged | +Inquiry |
Aldoa-1520M | Recombinant Mouse Aldoa protein, His-tagged | +Inquiry |
ALDOA-384H | Recombinant Human ALDOA Protein, His-tagged | +Inquiry |
◆ Lysates | ||
ALDOA-8912HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
ALDOA-8913HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (17)
Ask a questionALDOA protein expression can be regulated by various factors. For example, hypoxia, low oxygen levels, can induce the upregulation of ALDOA expression. Additionally, certain transcription factors and signaling pathways can influence ALDOA expression, although the full regulatory mechanisms are still being investigated.
Yes, mutations in the ALDOA gene have been reported in rare cases of hereditary fructose intolerance. These mutations impair the function of ALDOA, leading to metabolic disturbances upon fructose consumption.
Complete deficiency of ALDOA protein is not compatible with life, as it is required for normal glycolytic function in cells. However, mutations in the ALDOA gene that partially impair its function can result in hereditary fructose intolerance, an autosomal recessive disorder characterized by the inability to metabolize fructose.
Several compounds have been identified as potential inhibitors of ALDOA activity, including small molecules and natural compounds. However, their efficacy and specificity for ALDOA inhibition are still being studied. Currently, there are no known activators of ALDOA protein.
ALDOA protein has been found to interact with various molecules and proteins involved in glycolysis and other metabolic pathways. It has also been reported to interact with cytoskeletal proteins and actin, suggesting potential roles in cellular structure and motility.
Yes, ALDOA protein has been implicated in other biological processes besides glycolysis. It has been shown to play a role in cell proliferation, differentiation, and apoptosis. ALDOA has also been associated with the formation and maintenance of neuronal networks in the brain.
High expression of ALDOA protein has been observed in certain types of cancers, such as lung, breast, and ovarian cancer. It has been proposed as a potential biomarker for these cancers, although further research is needed to validate its clinical utility.
There is some evidence to suggest that ALDOA protein expression levels may have prognostic value in certain types of cancer. Higher expression of ALDOA has been correlated with poorer prognosis and reduced survival rates in some studies. However, more research is needed to establish its utility as a reliable prognostic marker.
There is emerging evidence suggesting that ALDOA protein may be a potential target for cancer therapy. ALDOA overexpression has been observed in various cancers and is associated with tumor growth, metastasis, and resistance to therapy. Inhibition of ALDOA has been shown to have anti-tumor effects in preclinical studies, making it a promising target for cancer therapy.
Yes, ALDOA protein has two known isoforms, ALDOA-1 and ALDOA-2, which are generated by alternative splicing of the ALDOA gene. ALDOA-1 is the major isoform expressed in most tissues, while ALDOA-2 is predominantly found in the brain.
Some studies have suggested a potential role of ALDOA protein in neurological disorders. ALDOA expression has been found to be dysregulated in certain neurodegenerative diseases, such as Alzheimer's disease and Parkinson's disease. However, the exact mechanisms by which ALDOA contributes to these disorders are still unclear and require further investigation.
Yes, ALDOA protein is known to undergo post-translational modifications, such as phosphorylation and acetylation. Phosphorylation of ALDOA has been shown to regulate its enzyme activity, subcellular localization, and protein-protein interactions. Acetylation of ALDOA has also been implicated in the regulation of its enzymatic activity.
ALDOA protein has been proposed as a biomarker for certain diseases. Increased ALDOA expression has been observed in various cancers, and its levels have been correlated with tumor aggressiveness and poor prognosis. Additionally, ALDOA has been suggested as a potential biomarker for myocardial infarction and acute kidney injury. However, more research is needed to validate ALDOA as a reliable biomarker in clinical settings.
Targeting ALDOA protein for the treatment of metabolic disorders is still in the early stages of research. While its involvement in glycolysis suggests it may be a potential target, further studies are needed to evaluate its feasibility and safety as a drug target.
While it is primarily known for its role in glycolysis, ALDOA protein has emerged as a potential target for cancer therapy. Inhibiting ALDOA activity has been explored as a strategy to selectively kill cancer cells or sensitize them to other anticancer treatments. However, more research is needed to develop effective and safe ALDOA-targeted therapies.
Although rare, there have been reports of genetic polymorphisms in the ALDOA gene associated with increased susceptibility to certain diseases, such as ischemic stroke and coronary artery disease. However, the functional implications of these polymorphisms need further investigation.
ALDOA protein has been shown to interact with various cellular pathways and proteins. For example, it has been found to interact with heat shock proteins, cytoskeletal proteins, and enzymes involved in glucose metabolism. These interactions suggest potential crosstalk between ALDOA and other cellular processes.
Customer Reviews (3)
Write a reviewIn addition to its remarkable quality and exceptional technical support, the ALDOA Protein boasts an impressive range of applications.
Its remarkable quality, versatility, and the manufacturer's commitment to customer satisfaction make it the perfect choice for researchers seeking a premier protein that will undoubtedly enhance their experimental endeavors.
The ALDOA Protein has exceeded my expectations by consistently delivering outstanding results and providing exceptional technical support.
Ask a Question for All ALDOA Products
Required fields are marked with *
My Review for All ALDOA Products
Required fields are marked with *
Inquiry Basket