Recombinant Human Aldolase B, Fructose-Bisphosphate, His-tagged
Cat.No. : | ALDOB-1918H |
Product Overview : | Recombinant humanALDOB protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Cat. No. : | ALDOB-1918H |
Description : | ALDOB isone of three known aldolase isoenzymes, and is found in kidney and smalladult intestine where it is associated with aldolases A or C. ALDOB catalyzesthe reversible cleavage of fructose 1-phosphate into dihydroxyacetonephosphate and glyceraldehyde. |
Form : | Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl. |
Molecular Weight : | 42 kDa(388aa) confirmed by MALDI-TOF |
Purity : | > 95%by SDS-PAGE |
Concentration : | 1 mg/ml(determined by Bradford assay) |
Sequences of aminoacids : | MGSSHHHHHHSSGLVPRGSH MGSHMAHRFP ALTQEQKKEL SEIAQSIVAN GKGILAADES VGTMGNRLQR IKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQ KDSQGKLFRN ILKEKGIVVG IKLDQGGAPL AGTNKETTIQ GLDGLSERCA QYKKDGVDFGKWRAVLRIAD QCPSSLAIQE NANALARYAS ICQQNGLVPI VEPEVIPDGD HDLEHCQYVT EKVLAAVYKALNDHHVYLEG TLLKPNMVTA GHACTKKYTP EQVAMATVTALHRTVPAAVP GICFLSGGMS EEDATLNLNA INLCPLPKPW KLSFSYGRAL QASALAAWGG KAANKEATQEAFMKRAMANC QAAKGQYVHT GSSGAASTQS LFTACYTY |
Storage : | Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Pathways : | FOXA2 and FOXA3 transcription factornetworks; Fructose and mannose metabolism; Fructose catabolism;Gluconeogenesis; Glucose metabolism; Glycolysis; Glycolysis (Embden-Meyerhofpathway); Glycolysis / Gluconeogenesis; Glycolysis and Gluconeogenesis;Metabolic pathways; Metabolism of carbohydrates; Pentose phosphate pathway |
Gene Name : | ALDOB aldolase B,fructose-bisphosphate [ Homo sapiens ] |
Official Symbol : | ALDOB |
Synonyms : | ALDOB; aldolase B, fructose-bisphosphate; ALDB;ALDO2; fructose-bisphosphate aldolase B; aldolase 2; liver-type aldolase;aldolase B, fructose-bisphosphatase; EC 4.1.2.13 |
Gene ID : | 229 |
mRNA Refseq : | NM_000035 |
Protein Refseq : | NP_000026 |
MIM : | 612724 |
UniProt ID : | P05062 |
Chromosome Location : | 9q21.3-q22.2 |
Function : | ATPase binding; cytoskeletal proteinbinding; fructose binding; fructose-bisphosphate aldolase activity; identicalprotein binding; lyase activity; phosphatidylcholine binding; protein binding |
Products Types
◆ Recombinant Protein | ||
ALDOB-1325R | Recombinant Rabbit ALDOB Protein (2-364 aa), His-tagged | +Inquiry |
ALDOB-326R | Recombinant Rabbit ALDOB Protein (2-364 aa), His-SUMO-tagged | +Inquiry |
Aldob-1596M | Recombinant Mouse Aldob Protein, Myc/DDK-tagged | +Inquiry |
ALDOB-9718Z | Recombinant Zebrafish ALDOB | +Inquiry |
ALDOB-456H | Recombinant Human ALDOB Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
ALDOB-8911HCL | Recombinant Human ALDOB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionHereditary fructose intolerance is caused by a genetic mutation in the ALDOB gene, which leads to a deficiency or complete absence of the ALDOB protein. Without functioning ALDOB protein, the body is unable to properly metabolize fructose, leading to a build-up of toxic byproducts and causing the symptoms of HFI.
Yes, there are multiple mutations identified in the ALDOB gene that can cause hereditary fructose intolerance. These mutations can vary in their severity and impact on the function of the ALDOB protein.
Yes, mutations in the ALDOB gene can have other health implications. In some cases, mutations that cause a partial deficiency of the ALDOB protein may lead to a milder form of fructose intolerance or cause symptoms only when excessive amounts of fructose are consumed. Additionally, there is some evidence to suggest that ALDOB gene mutations may be associated with an increased risk of developing certain types of liver diseases. However, further research is needed to fully understand the potential implications.
Yes, prenatal testing is available for hereditary fructose intolerance. It involves analyzing fetal DNA obtained through procedures like chorionic villus sampling (CVS) or amniocentesis to identify mutations in the ALDOB gene. This allows for early detection of the condition, aiding in family planning and preparation for managing the condition after birth.
The ALDOB protein is primarily involved in fructose metabolism, but it also has other functions. It plays a role in gluconeogenesis, a process in which the liver produces glucose from non-carbohydrate sources. It is also involved in maintaining the balance of sugar molecules in the body and supporting normal liver function.
Hereditary fructose intolerance is typically diagnosed through a combination of clinical symptoms, biochemical testing, and genetic testing. Symptoms of the condition may include abdominal pain, nausea, vomiting, and low blood sugar levels. Biochemical testing involves measuring the levels of certain metabolites, such as fructose and its byproducts, in the blood or urine. Genetic testing can confirm the presence of specific mutations in the ALDOB gene.
Customer Reviews (3)
Write a reviewIt has been extensively used in protein-protein interaction studies, enzymatic assays, and structural analyses, showcasing its reliability and adaptability in diverse research areas.
With the ALDOB Protein, I have the confidence to generate critical insights and drive significant advancements in my field.
I am certain of obtaining reliable and reproducible results, enabling me to contribute to scientific progress and make new discoveries.
Ask a Question for All ALDOB Products
Required fields are marked with *
My Review for All ALDOB Products
Required fields are marked with *
Inquiry Basket