Recombinant Human ALOX15
Cat.No. : | ALOX15-26020TH |
Product Overview : | Recombinant full length Human 15 Lipoxygenase 1 with N terminal proprietary tag; Predicted MWt 98.56 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Arachidonate 15-lipoxygenase is an enzyme that in humans is encoded by the ALOX15 gene. |
Protein length : | 662 amino acids |
Molecular Weight : | 98.560kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLW PARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNW ISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDL PVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDL DDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQL PRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEIN VRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSS FCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVS LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQ ARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIR NAKLDMPYEYLRPSVVENSVAI |
Sequence Similarities : | Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain. |
Gene Name : | ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens ] |
Official Symbol : | ALOX15 |
Synonyms : | ALOX15; arachidonate 15-lipoxygenase; 15 LOX 1; |
Gene ID : | 246 |
mRNA Refseq : | NM_001140 |
Protein Refseq : | NP_001131 |
MIM : | 152392 |
Uniprot ID : | P16050 |
Chromosome Location : | 17p13.3 |
Pathway : | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Linoleic acid metabolism, organism-specific biosystem; |
Function : | arachidonate 12-lipoxygenase activity; arachidonate 15-lipoxygenase activity; hepoxilin-epoxide hydrolase activity; iron ion binding; lipoxygenase activity; |
Products Types
◆ Recombinant Protein | ||
ALOX15-324H | Recombinant Human ALOX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALOX15-001H | Recombinant Human ALOX15 Protein, FLAG-tagged | +Inquiry |
ALOX15-292R | Recombinant Rat ALOX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALOX15-485H | Recombinant Human ALOX15 Protein, GST-tagged | +Inquiry |
ALOX15-3375H | Recombinant Human ALOX15 protein, His-tagged | +Inquiry |
◆ Lysates | ||
ALOX15-8897HCL | Recombinant Human ALOX15 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (14)
Ask a questionIt can regulate cell proliferation by regulating various cell signaling pathways and influencing cell cycle.
The oxidative stress response initiated by ALOX15 can induce cells to secrete a variety of cytokines, thus participating in the immune response.
ALOX15 and GSTP1 gene variants may affect how well BLCA patients respond to chemotherapy.
ALOX15 deficiency may lead to a variety of effects such as alveolar hyperdilation, cardiomyopathy, and metabolic syndrome.
ALOX15 is involved in many cell signaling pathways, such as PI3K/AKT pathway, MAPK pathway, NF-κB pathway, etc.
ALOX15 is involved in a variety of inflammatory reactions, such as asthma, arthritis, and skin inflammation.
ALOX15 is involved in the pathogenesis of asthma, mediating airway stenosis and inflammation through the synthesis of leukotrienes.
The effects of ALOX15 vary in different tumor types, such as acting as an inhibitor in colorectal cancer and promoting tumor cell growth and invasion in prostate cancer.
ALOX15 can affect apoptosis by regulating ROS levels and influencing cell signaling pathways.
Mutations in ALOX15 have been linked to diseases such as asthma and Behcet's disease.
This protein is involved in the process of neural development, such as promoting the growth of nerve cells and affecting brain development.
Oxidative stress response initiated by ALOX15 produces a large number of ROS, which affects various cell functions, such as apoptosis and cell proliferation.
It is involved in the pathogenesis of many diseases, such as asthma, rheumatoid arthritis, and skin inflammation.
It is involved in various functions such as keratinocyte differentiation and cell cycle regulation.
Customer Reviews (4)
Write a reviewGood fluorescence and absorption properties.
ALOX15 has good stability in different environments and is not easily degraded.
The effects of the recombinant proteins on the pathogenesis of related diseases were evaluated by animal models or in vitro experiments and found to be very good.
The catalytic activity of ALOX15 protein is very excellent, and it can efficiently promote the progress of chemical reactions, showing excellent catalytic performance.
Ask a Question for All ALOX15 Products
Required fields are marked with *
My Review for All ALOX15 Products
Required fields are marked with *
Inquiry Basket