Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ALOX15

Cat.No. : ALOX15-26020TH
Product Overview : Recombinant full length Human 15 Lipoxygenase 1 with N terminal proprietary tag; Predicted MWt 98.56 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Arachidonate 15-lipoxygenase is an enzyme that in humans is encoded by the ALOX15 gene.
Protein length : 662 amino acids
Molecular Weight : 98.560kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLW PARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNW ISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDL PVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDL DDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQL PRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEIN VRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSS FCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVS LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQ ARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIR NAKLDMPYEYLRPSVVENSVAI
Sequence Similarities : Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.
Gene Name : ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens ]
Official Symbol : ALOX15
Synonyms : ALOX15; arachidonate 15-lipoxygenase; 15 LOX 1;
Gene ID : 246
mRNA Refseq : NM_001140
Protein Refseq : NP_001131
MIM : 152392
Uniprot ID : P16050
Chromosome Location : 17p13.3
Pathway : Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Linoleic acid metabolism, organism-specific biosystem;
Function : arachidonate 12-lipoxygenase activity; arachidonate 15-lipoxygenase activity; hepoxilin-epoxide hydrolase activity; iron ion binding; lipoxygenase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (14)

Ask a question
In what way does ALOX15 regulate cell proliferation? 12/17/2022

It can regulate cell proliferation by regulating various cell signaling pathways and influencing cell cycle.

How does oxidative stress initiated by ALOX15 participate in immune response? 08/06/2022

The oxidative stress response initiated by ALOX15 can induce cells to secrete a variety of cytokines, thus participating in the immune response.

What is the effect of ALOX15 and GSTP1 gene variation on chemotherapy response of BLCA patients? 05/23/2022

ALOX15 and GSTP1 gene variants may affect how well BLCA patients respond to chemotherapy.

What effect does the loss of ALOX15 have on the body? 05/08/2022

ALOX15 deficiency may lead to a variety of effects such as alveolar hyperdilation, cardiomyopathy, and metabolic syndrome.

Which cell signaling pathways are involved in ALOX15? 04/11/2021

ALOX15 is involved in many cell signaling pathways, such as PI3K/AKT pathway, MAPK pathway, NF-κB pathway, etc.

What inflammatory reactions does ALOX15 participate in? 03/28/2021

ALOX15 is involved in a variety of inflammatory reactions, such as asthma, arthritis, and skin inflammation.

What is the role of ALOX15 in asthma? 03/05/2021

ALOX15 is involved in the pathogenesis of asthma, mediating airway stenosis and inflammation through the synthesis of leukotrienes.

What is the role of ALOX15 in tumorigenesis and development? 02/15/2021

The effects of ALOX15 vary in different tumor types, such as acting as an inhibitor in colorectal cancer and promoting tumor cell growth and invasion in prostate cancer.

How does ALOX15 regulate apoptosis? 12/11/2020

ALOX15 can affect apoptosis by regulating ROS levels and influencing cell signaling pathways.

What diseases do mutations in ALOX15 cause? 09/18/2020

Mutations in ALOX15 have been linked to diseases such as asthma and Behcet's disease.

What is the role of ALOX15 in neurodevelopment? 09/15/2020

This protein is involved in the process of neural development, such as promoting the growth of nerve cells and affecting brain development.

How does the oxidative stress response initiated by ALOX15 affect cell function? 09/07/2020

Oxidative stress response initiated by ALOX15 produces a large number of ROS, which affects various cell functions, such as apoptosis and cell proliferation.

In what diseases does ALOX15 play a role? 03/19/2020

It is involved in the pathogenesis of many diseases, such as asthma, rheumatoid arthritis, and skin inflammation.

What role does ALOX15 play in the function of keratinocytes? 12/17/2019

It is involved in various functions such as keratinocyte differentiation and cell cycle regulation.

Customer Reviews (4)

Write a review
Reviews
12/19/2022

    Good fluorescence and absorption properties.

    11/26/2021

      ALOX15 has good stability in different environments and is not easily degraded.

      08/26/2021

        The effects of the recombinant proteins on the pathogenesis of related diseases were evaluated by animal models or in vitro experiments and found to be very good.

        03/11/2021

          The catalytic activity of ALOX15 protein is very excellent, and it can efficiently promote the progress of chemical reactions, showing excellent catalytic performance.

          Ask a Question for All ALOX15 Products

          Required fields are marked with *

          My Review for All ALOX15 Products

          Required fields are marked with *

          0

          Inquiry Basket

          cartIcon
          logo

          FOLLOW US

          Terms and Conditions        Privacy Policy

          Copyright © 2024 Creative BioMart. All Rights Reserved.

          Contact Us

          • /

          Stay Updated on the Latest Bioscience Trends