Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ALOX5

Cat.No. : ALOX5-26026TH
Product Overview : Recombinant full length Human 5 Lipoxygenase with N terminal proprietary tag; Predicted MWt 100.21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Protein length : 674 amino acids
Molecular Weight : 100.210kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDK PFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDD WYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKC HKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS SWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQG NIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANK IVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAH VRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRA MKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRG RKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYD WCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRK NLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI
Sequence Similarities : Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.
Gene Name : ALOX5 arachidonate 5-lipoxygenase [ Homo sapiens ]
Official Symbol : ALOX5
Synonyms : ALOX5; arachidonate 5-lipoxygenase; 5 LOX;
Gene ID : 240
mRNA Refseq : NM_000698
Protein Refseq : NP_000689
MIM : 152390
Uniprot ID : P09917
Chromosome Location : 10q11.2
Pathway : Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem; Leukotriene synthesis, organism-specific biosystem;
Function : arachidonate 5-lipoxygenase activity; arachidonate 5-lipoxygenase activity; iron ion binding; lipoxygenase activity; metal ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (13)

Ask a question
On which chromosome is the ALOX5 coding gene? 02/15/2023

The ALOX5 coding gene is located on human chromosome 10.

What are ALOX5 inhibitors? What is their mechanism of action? 12/30/2022

Currently known ALOX5 inhibitors include trypanosomamine, Ritopane, MK-886, etc., whose mechanism of action is to interfere with the expression or function of ALOX5 in different ways, thereby playing an anti-inflammatory or anti-tumor role.

What biological processes is ALOX5 involved in? 12/27/2022

ALOX5 is involved in a variety of biological processes, including apoptosis, cell proliferation, inflammatory response, and cancer metastasis.

What factors can regulate ALOX5 gene expression? 10/20/2022

The gene expression can be regulated by a variety of factors such as prostaglandins, cytokines and interferons.

Which foods inhibit ALOX5 activity? 04/08/2022

Some foods rich in polyphenols, such as cucumbers, tomatoes, grapes, green tea, etc., are thought to inhibit ALOX5 activity.

What cell types have high levels of ALOX5 gene expression? 04/07/2022

In general, the ALOX5 gene is highly expressed in eosinophils and monocytes.

What is the function of the ALOX5 promoter region? 01/08/2022

The ALOX5 promoter region is the starting point of gene transcription and is responsible for mediating the transcription regulation of the ALOX5 gene.

How to inhibit the effect of ALOX5 in tumor treatment with drugs? 12/18/2021

Drugs that block the ALOX5 signaling pathway, such as Zileuton, MK886, and A861, have been shown to inhibit tumor cell proliferation and invasion. Currently, there are also many researchers who are exploring ALOX5 in tumors.

What diseases can ALOX5 gene mutation cause? 01/17/2021

ALOX5 gene mutation may cause asthma, allergic rhinitis, eczema and other allergic diseases.

What is 5-HETE? How is it related to ALOX5? 12/02/2020

5-HETE is one of the representative products of ALOX5 catalyzed synthesis, and is an activator of platelets and neutrophils.

What is the specific mechanism by which ALOX5 mediates the occurrence of human cancer? 11/07/2019

There is no definite answer to this question. Current studies believe that ALOX5 can affect the occurrence, development and metastasis of tumors through multiple ways, including regulating the proliferation, apoptosis, invasion and metastasis of tumor cells.

In what areas can ALOX5 knockout mouse models be used for research? 09/03/2019

ALOX5 knockout mouse models can be used to study a variety of biological processes and diseases, such as immune regulation, inflammation, asthma, eczema, autoimmunity, etc.

How to detect the expression of ALOX5 gene? 07/27/2019

At present, the commonly used methods include real-time fluorescent quantitative PCR, Northern blot, Western blot, etc.

Customer Reviews (3)

Write a review
Reviews
05/09/2022

    After ALOX5 application, the background of the Western blot was very clean with no nonspecific signal.

    08/10/2020

      ALOX5 significantly improved the experimental accuracy and made the experimental results more reliable.

      05/07/2020

        I appreciate the stability of ALOX5, which can be kept at room temperature for several days without spoilage.

        Ask a Question for All ALOX5 Products

        Required fields are marked with *

        My Review for All ALOX5 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends