Recombinant Human ALOX5
Cat.No. : | ALOX5-26026TH |
Product Overview : | Recombinant full length Human 5 Lipoxygenase with N terminal proprietary tag; Predicted MWt 100.21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. |
Protein length : | 674 amino acids |
Molecular Weight : | 100.210kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDK PFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDD WYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKC HKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS SWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQG NIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANK IVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAH VRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRA MKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRG RKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYD WCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRK NLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI |
Sequence Similarities : | Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain. |
Gene Name : | ALOX5 arachidonate 5-lipoxygenase [ Homo sapiens ] |
Official Symbol : | ALOX5 |
Synonyms : | ALOX5; arachidonate 5-lipoxygenase; 5 LOX; |
Gene ID : | 240 |
mRNA Refseq : | NM_000698 |
Protein Refseq : | NP_000689 |
MIM : | 152390 |
Uniprot ID : | P09917 |
Chromosome Location : | 10q11.2 |
Pathway : | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem; Leukotriene synthesis, organism-specific biosystem; |
Function : | arachidonate 5-lipoxygenase activity; arachidonate 5-lipoxygenase activity; iron ion binding; lipoxygenase activity; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
ALOX5-053H | Recombinant Human ALOX5 Protein | +Inquiry |
ALOX5-64H | Recombinant Human ALOX5 Protein | +Inquiry |
ALOX5-294R | Recombinant Rat ALOX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Alox5-121R | Recombinant Rat Alox5 Protein, His-tagged | +Inquiry |
ALOX5-483M | Recombinant Mouse ALOX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
ALOX5-8896HCL | Recombinant Human ALOX5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (13)
Ask a questionThe ALOX5 coding gene is located on human chromosome 10.
Currently known ALOX5 inhibitors include trypanosomamine, Ritopane, MK-886, etc., whose mechanism of action is to interfere with the expression or function of ALOX5 in different ways, thereby playing an anti-inflammatory or anti-tumor role.
ALOX5 is involved in a variety of biological processes, including apoptosis, cell proliferation, inflammatory response, and cancer metastasis.
The gene expression can be regulated by a variety of factors such as prostaglandins, cytokines and interferons.
Some foods rich in polyphenols, such as cucumbers, tomatoes, grapes, green tea, etc., are thought to inhibit ALOX5 activity.
In general, the ALOX5 gene is highly expressed in eosinophils and monocytes.
The ALOX5 promoter region is the starting point of gene transcription and is responsible for mediating the transcription regulation of the ALOX5 gene.
Drugs that block the ALOX5 signaling pathway, such as Zileuton, MK886, and A861, have been shown to inhibit tumor cell proliferation and invasion. Currently, there are also many researchers who are exploring ALOX5 in tumors.
ALOX5 gene mutation may cause asthma, allergic rhinitis, eczema and other allergic diseases.
5-HETE is one of the representative products of ALOX5 catalyzed synthesis, and is an activator of platelets and neutrophils.
There is no definite answer to this question. Current studies believe that ALOX5 can affect the occurrence, development and metastasis of tumors through multiple ways, including regulating the proliferation, apoptosis, invasion and metastasis of tumor cells.
ALOX5 knockout mouse models can be used to study a variety of biological processes and diseases, such as immune regulation, inflammation, asthma, eczema, autoimmunity, etc.
At present, the commonly used methods include real-time fluorescent quantitative PCR, Northern blot, Western blot, etc.
Customer Reviews (3)
Write a reviewAfter ALOX5 application, the background of the Western blot was very clean with no nonspecific signal.
ALOX5 significantly improved the experimental accuracy and made the experimental results more reliable.
I appreciate the stability of ALOX5, which can be kept at room temperature for several days without spoilage.
Ask a Question for All ALOX5 Products
Required fields are marked with *
My Review for All ALOX5 Products
Required fields are marked with *
Inquiry Basket