Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human AMBN

Cat.No. : AMBN-27234TH
Product Overview : Recombinant full length Human AMBN with N terminal proprrietary tag; Predicted MW 75.24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. This gene is located in the calcium-binding phosphoprotein gene cluster on chromosome 4. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect.
Protein length : 447 amino acids
Molecular Weight : 75.240kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Ameloblast-specific. Located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMA SLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLL PPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQ PGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQEGEL PLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQ GPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPG MLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFP GFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEE GGAQGSPMPEANPDNLENPAFLTELEPAPHAGLLALPKDD IPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDA DMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHD AWHFQEP
Sequence Similarities : Belongs to the ameloblastin family.
Gene Name : AMBN ameloblastin (enamel matrix protein) [ Homo sapiens ]
Official Symbol : AMBN
Synonyms : AMBN; ameloblastin (enamel matrix protein); ameloblastin, enamel matrix protein; ameloblastin;
Gene ID : 258
mRNA Refseq : NM_016519
Protein Refseq : NP_057603
MIM : 601259
Uniprot ID : Q9NP70
Chromosome Location : 4q21
Function : growth factor activity; structural constituent of tooth enamel;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
Can AMBN be used as a biomarker for enamel defects or dental disorders, and what are the diagnostic implications of its expression patterns? 09/05/2022

AMBN expression patterns and levels can serve as biomarkers for enamel defects or dental disorders, providing diagnostic information about the integrity and quality of the enamel layer.

Can AMBN-derived peptides or fragments be used as therapeutic agents for enamel repair or regeneration? 04/09/2021

AMBN-derived peptides or fragments may have potential as therapeutic agents for enamel repair or regeneration, promoting enamel formation or stimulating the differentiation of dental stem cells.

How does AMBN contribute to the mechanical properties of enamel, such as hardness, resilience, and resistance to wear? 10/05/2020

AMBN contributes to the mechanical properties of enamel, such as its hardness, resilience, and resistance to wear, through its organization and interaction with other enamel proteins.

What are the consequences of AMBN mutations or genetic variations on enamel formation and tooth integrity, and how do these variations contribute to dental phenotypes or disorders? 08/05/2019

Mutations or genetic variations in the AMBN gene can lead to enamel defects and dental phenotypes, highlighting the importance of AMBN in enamel formation and integrity.

What are the post-translational modifications of AMBN, such as phosphorylation or glycosylation, and how do these modifications influence its function and assembly into the developing enamel matrix? 04/26/2019

AMBN undergoes post-translational modifications, including phosphorylation and glycosylation, which play a role in its functional properties and assembly into the developing enamel matrix.

What are the mechanisms underlying AMBN secretion and transport to the enamel matrix, and how can these processes be modulated for therapeutic interventions in enamel-related disorders? 03/14/2019

The secretion and transport of AMBN to the enamel matrix involve specific mechanisms, including vesicular trafficking and protein-protein interactions, which can be targeted for therapeutic interventions in enamel-related disorders.

How does AMBN interact with dental stem cells or progenitor cells, and what is its role in tooth regeneration or repair processes? 09/19/2018

AMBN interacts with dental stem cells or progenitor cells, influencing their differentiation and contributing to tooth regeneration or repair processes.

What are the key signaling pathways or regulatory factors that control AMBN expression and secretion during tooth development? 06/24/2018

The expression and secretion of AMBN during tooth development are regulated by various signaling pathways, including those involving transcription factors, growth factors, and extracellular matrix components.

How does AMBN interact with other enamel matrix proteins, such as amelogenin and enamelin, and what are the functional consequences of these interactions? 10/04/2017

AMBN interacts with other enamel matrix proteins, such as amelogenin and enamelin, forming a complex network that contributes to the formation of the enamel matrix and its subsequent mineralization.

What is the role of AMBN in enamel development, and how does it contribute to enamel mineralization and structure? 09/07/2017

AMBN is a critical protein involved in enamel development and is responsible for regulating enamel mineralization and determining the structure and hardness of the enamel layer.

Customer Reviews (3)

Write a review
Reviews
08/09/2022

    Reduced assay interference from complex sample backgrounds.

    02/20/2022

      High-throughput screening compatibility for rapid data generation.

      08/17/2020

        Reliable detection of protein localization and trafficking.

        Ask a Question for All AMBN Products

        Required fields are marked with *

        My Review for All AMBN Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends