Recombinant Human AMBN
Cat.No. : | AMBN-27234TH |
Product Overview : | Recombinant full length Human AMBN with N terminal proprrietary tag; Predicted MW 75.24kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. This gene is located in the calcium-binding phosphoprotein gene cluster on chromosome 4. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect. |
Protein length : | 447 amino acids |
Molecular Weight : | 75.240kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Ameloblast-specific. Located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMA SLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLL PPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQ PGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQEGEL PLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQ GPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPG MLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFP GFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEE GGAQGSPMPEANPDNLENPAFLTELEPAPHAGLLALPKDD IPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDA DMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHD AWHFQEP |
Sequence Similarities : | Belongs to the ameloblastin family. |
Gene Name : | AMBN ameloblastin (enamel matrix protein) [ Homo sapiens ] |
Official Symbol : | AMBN |
Synonyms : | AMBN; ameloblastin (enamel matrix protein); ameloblastin, enamel matrix protein; ameloblastin; |
Gene ID : | 258 |
mRNA Refseq : | NM_016519 |
Protein Refseq : | NP_057603 |
MIM : | 601259 |
Uniprot ID : | Q9NP70 |
Chromosome Location : | 4q21 |
Function : | growth factor activity; structural constituent of tooth enamel; |
Products Types
◆ Recombinant Protein | ||
Ambn-498M | Recombinant Mouse Ambn Protein, His (Fc)-Avi-tagged | +Inquiry |
AMBN-1022H | Recombinant Human AMBN Protein, His-tagged | +Inquiry |
AMBN-1855H | Recombinant Human AMBN Protein (27-447 aa), His-tagged | +Inquiry |
AMBN-301R | Recombinant Rat AMBN Protein, His (Fc)-Avi-tagged | +Inquiry |
Ambn-3405M | Recombinant Mouse Ambn, His-tagged | +Inquiry |
◆ Lysates | ||
AMBN-69HCL | Recombinant Human AMBN cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionAMBN expression patterns and levels can serve as biomarkers for enamel defects or dental disorders, providing diagnostic information about the integrity and quality of the enamel layer.
AMBN-derived peptides or fragments may have potential as therapeutic agents for enamel repair or regeneration, promoting enamel formation or stimulating the differentiation of dental stem cells.
AMBN contributes to the mechanical properties of enamel, such as its hardness, resilience, and resistance to wear, through its organization and interaction with other enamel proteins.
Mutations or genetic variations in the AMBN gene can lead to enamel defects and dental phenotypes, highlighting the importance of AMBN in enamel formation and integrity.
AMBN undergoes post-translational modifications, including phosphorylation and glycosylation, which play a role in its functional properties and assembly into the developing enamel matrix.
The secretion and transport of AMBN to the enamel matrix involve specific mechanisms, including vesicular trafficking and protein-protein interactions, which can be targeted for therapeutic interventions in enamel-related disorders.
AMBN interacts with dental stem cells or progenitor cells, influencing their differentiation and contributing to tooth regeneration or repair processes.
The expression and secretion of AMBN during tooth development are regulated by various signaling pathways, including those involving transcription factors, growth factors, and extracellular matrix components.
AMBN interacts with other enamel matrix proteins, such as amelogenin and enamelin, forming a complex network that contributes to the formation of the enamel matrix and its subsequent mineralization.
AMBN is a critical protein involved in enamel development and is responsible for regulating enamel mineralization and determining the structure and hardness of the enamel layer.
Customer Reviews (3)
Write a reviewReduced assay interference from complex sample backgrounds.
High-throughput screening compatibility for rapid data generation.
Reliable detection of protein localization and trafficking.
Ask a Question for All AMBN Products
Required fields are marked with *
My Review for All AMBN Products
Required fields are marked with *
Inquiry Basket