Recombinant Human AP1S1
Cat.No. : | AP1S1-27354TH |
Product Overview : | Recombinant full length Human AP1S1 isoform 2 with a N terminal proprietary tag; Predicted MWt 40.74 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. |
Protein length : | 133 amino acids |
Molecular Weight : | 40.740kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVL ARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELIT LELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG GDVQDTSTFPFSH |
Sequence Similarities : | Belongs to the adaptor complexes small subunit family. |
Gene Name : | AP1S1 adaptor-related protein complex 1, sigma 1 subunit [ Homo sapiens ] |
Official Symbol : | AP1S1 |
Synonyms : | AP1S1; adaptor-related protein complex 1, sigma 1 subunit; CLAPS1; AP-1 complex subunit sigma-1A; AP 1 complex subunit sigma 1A; AP19; clathrin assembly protein complex 1 sigma 1A small chain; clathrin coat assembly protein AP19; clathrin associated/assem |
Gene ID : | 1174 |
mRNA Refseq : | NM_001283 |
Protein Refseq : | NP_001274 |
MIM : | 603531 |
Uniprot ID : | P61966 |
Chromosome Location : | 7 |
Pathway : | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; HIV Infection, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem; Lysosome, organism-specific biosystem; |
Function : | protein transporter activity; |
Products Types
◆ Recombinant Protein | ||
AP1S1-598M | Recombinant Mouse AP1S1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP1S1-184H | Recombinant Human AP1S1 Protein, His-tagged | +Inquiry |
AP1S1-10638Z | Recombinant Zebrafish AP1S1 | +Inquiry |
AP1S1-1735M | Recombinant Mouse AP1S1 Protein | +Inquiry |
Ap1s1-3529M | Recombinant Mouse Ap1s1, His-tagged | +Inquiry |
◆ Lysates | ||
AP1S1-8817HCL | Recombinant Human AP1S1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (19)
Ask a questionAt present, AP1S1 is mainly used in the therapeutic field, and has not been widely used in the preparation of diagnostic reagents.
Previous studies have shown that AP1S1 has potential application value in tumor therapy, and the specific application needs further study.
As an immunomodulator, AP1S1 is expected to become a new immunotherapy strategy to help patients fight cancer, viruses and other diseases.
Yes, AP1S1 can be used as an adjunct therapeutic means, combined with radiotherapy, chemotherapy and other therapeutic means to improve the therapeutic effect.
AP1S1 gene is involved in important biological processes such as intracellular signaling and cargo transport, and has a certain relationship with tumor invasion and metastasis.
The AP1S1 can enhance the immune response of the body and has a good therapeutic potential for viral infection.
Recombinant protein AP1S1 can regulate the immune response in the tumor microenvironment and play an anti-tumor role.
The production technology of AP1S1 has been relatively mature, and some pharmaceutical companies have begun large-scale production.
According to existing studies, AP1S1 may have application prospects in tumor, autoimmune disease, viral infection, etc.
AP1S1 as a protein drug needs to be injected, and oral method is not practical.
The quality of AP1S1 should meet certain standards of purity, activity, stability, non-toxicity, no bacterial contamination and so on.
AP1S1 can play an important role in antiviral, anti-tumor and immune response regulation by interfering with intracellular cargo transport mechanisms, and is expected to become a new therapeutic means.
AP1S1 is involved in the transport of substances between the endoplasmic reticulum and the Golgi apparatus, intracellular signaling and cytoskeleton formation and other biological processes.
Recombinant AP1S1 has not been shown to have a tumor preventive effect.
Recombinant AP1S1 can regulate the overactivation of the immune response in patients with autoimmune disease and reduce symptoms.
Recombinant AP1S1 protein can enhance immune response and enhance immunovirulence by interfering with cargo transport and other mechanisms.
There are two common methods for preparing AP1S1 : prokaryotic expression system and mammalian expression system.
Antibody gene therapy targets specific tumor targets, while recombinant AP1S1 exerts its role by regulating immune responses and interfering with cargo transport.
Recombinant AP1S1 can inhibit the expression of a series of pro-inflammatory cytokines and play an anti-inflammatory role.
Customer Reviews (6)
Write a reviewThe production process focuses on the recycling of resources, and the waste is reused, reducing the consumption of natural resources.
Background of AP1S1 in Western blot was very clean and showed good antibody specificity.
Under different experimental conditions, the stability of AP1S is still very good, indicating that it has a wide range of applications and adaptability.
Reproducibility of AP1S1 is very good, and I can get consistent results from each experiment, which makes me more confident in the experimental results.
The short half-life and high clearance characteristics of AP1S1 make it better adapted to the needs of clinical treatment, and provide patients with safer and more effective treatment options.
The short half-life and high clearance characteristics of AP1S make it able to effectively avoid drug accumulation and side effects, and provide a strong guarantee for the health of patients.
Ask a Question for All AP1S1 Products
Required fields are marked with *
My Review for All AP1S1 Products
Required fields are marked with *
Inquiry Basket