Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human AP1S1

Cat.No. : AP1S1-27354TH
Product Overview : Recombinant full length Human AP1S1 isoform 2 with a N terminal proprietary tag; Predicted MWt 40.74 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle.
Protein length : 133 amino acids
Molecular Weight : 40.740kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVL ARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELIT LELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG GDVQDTSTFPFSH
Sequence Similarities : Belongs to the adaptor complexes small subunit family.
Gene Name : AP1S1 adaptor-related protein complex 1, sigma 1 subunit [ Homo sapiens ]
Official Symbol : AP1S1
Synonyms : AP1S1; adaptor-related protein complex 1, sigma 1 subunit; CLAPS1; AP-1 complex subunit sigma-1A; AP 1 complex subunit sigma 1A; AP19; clathrin assembly protein complex 1 sigma 1A small chain; clathrin coat assembly protein AP19; clathrin associated/assem
Gene ID : 1174
mRNA Refseq : NM_001283
Protein Refseq : NP_001274
MIM : 603531
Uniprot ID : P61966
Chromosome Location : 7
Pathway : Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; HIV Infection, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem; Lysosome, organism-specific biosystem;
Function : protein transporter activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (19)

Ask a question
Which diagnostic reagents can AP1S1 be used to prepare? 04/26/2022

At present, AP1S1 is mainly used in the therapeutic field, and has not been widely used in the preparation of diagnostic reagents.

Can AP1S1 be used in the treatment of tumor? 07/10/2021

Previous studies have shown that AP1S1 has potential application value in tumor therapy, and the specific application needs further study.

What is the relationship between AP1S1 and immunotherapy? 06/21/2021

As an immunomodulator, AP1S1 is expected to become a new immunotherapy strategy to help patients fight cancer, viruses and other diseases.

Can AP1S1 be used in combination with other treatments? 04/20/2021

Yes, AP1S1 can be used as an adjunct therapeutic means, combined with radiotherapy, chemotherapy and other therapeutic means to improve the therapeutic effect.

Does AP1S1 gene have an effect on tumor invasion and metastasis? 04/15/2021

AP1S1 gene is involved in important biological processes such as intracellular signaling and cargo transport, and has a certain relationship with tumor invasion and metastasis.

What are the new ideas of recombinant AP1S1 in the treatment of viral infection? 02/03/2021

The AP1S1 can enhance the immune response of the body and has a good therapeutic potential for viral infection.

What is the effect of AP1S1 on tumor microenvironment? 10/10/2020

Recombinant protein AP1S1 can regulate the immune response in the tumor microenvironment and play an anti-tumor role.

Is the production technology of AP1S1 mature? 08/03/2020

The production technology of AP1S1 has been relatively mature, and some pharmaceutical companies have begun large-scale production.

In which diseases does AP1S1 have application prospects? 02/10/2020

According to existing studies, AP1S1 may have application prospects in tumor, autoimmune disease, viral infection, etc.

Can AP1S1 be administered orally? 11/25/2019

AP1S1 as a protein drug needs to be injected, and oral method is not practical.

What is the quality control standard of AP1S1 ? 08/14/2019

The quality of AP1S1 should meet certain standards of purity, activity, stability, non-toxicity, no bacterial contamination and so on.

What is the role of AP1S1 in clinical medicine? 08/08/2019

AP1S1 can play an important role in antiviral, anti-tumor and immune response regulation by interfering with intracellular cargo transport mechanisms, and is expected to become a new therapeutic means.

What is the biological function of AP1S1 ? 07/18/2019

AP1S1 is involved in the transport of substances between the endoplasmic reticulum and the Golgi apparatus, intracellular signaling and cytoskeleton formation and other biological processes.

Can recombinant AP1S1 be used as a cancer prevention tool? 04/10/2019

Recombinant AP1S1 has not been shown to have a tumor preventive effect.

What is the role of recombinant AP1S1 in the treatment of autoimmune diseases? 03/31/2019

Recombinant AP1S1 can regulate the overactivation of the immune response in patients with autoimmune disease and reduce symptoms.

Does AP1S1 have immunovirulence enhancement effect? 03/27/2019

Recombinant AP1S1 protein can enhance immune response and enhance immunovirulence by interfering with cargo transport and other mechanisms.

What is the preparation method of AP1S1 ? 03/25/2019

There are two common methods for preparing AP1S1 : prokaryotic expression system and mammalian expression system.

What are the similarities and differences between antibody gene therapy and AP1S1 ? 02/09/2019

Antibody gene therapy targets specific tumor targets, while recombinant AP1S1 exerts its role by regulating immune responses and interfering with cargo transport.

What is the effect of AP1S1 on proinflammatory cytokines? 01/27/2019

Recombinant AP1S1 can inhibit the expression of a series of pro-inflammatory cytokines and play an anti-inflammatory role.

Customer Reviews (6)

Write a review
Reviews
11/04/2022

    The production process focuses on the recycling of resources, and the waste is reused, reducing the consumption of natural resources.

    09/24/2022

      Background of AP1S1 in Western blot was very clean and showed good antibody specificity.

      07/11/2021

        Under different experimental conditions, the stability of AP1S is still very good, indicating that it has a wide range of applications and adaptability.

        05/12/2021

          Reproducibility of AP1S1 is very good, and I can get consistent results from each experiment, which makes me more confident in the experimental results.

          07/08/2020

            The short half-life and high clearance characteristics of AP1S1 make it better adapted to the needs of clinical treatment, and provide patients with safer and more effective treatment options.

            03/09/2019

              The short half-life and high clearance characteristics of AP1S make it able to effectively avoid drug accumulation and side effects, and provide a strong guarantee for the health of patients.

              Ask a Question for All AP1S1 Products

              Required fields are marked with *

              My Review for All AP1S1 Products

              Required fields are marked with *

              0

              Inquiry Basket

              cartIcon
              logo

              FOLLOW US

              Terms and Conditions        Privacy Policy

              Copyright © 2024 Creative BioMart. All Rights Reserved.

              Contact Us

              • /

              Stay Updated on the Latest Bioscience Trends