Recombinant Human AP2A1, His-tagged
Cat.No. : | AP2A1-27357TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 734-950 of Human AP2 alpha isoform B, with a N terminal His tag; predicted MWt 25kDa: |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Isoform A expressed in forebrain, skeletal muscle, spinal cord, cerebellum, salivary gland, heart and colon. Isoform B is widely expressed in tissues and also in breast cancer and in prostate carcinoma cells. |
Form : | Lyophilised:Reconstitution with 45 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FENQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQNFSPTV VHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRD FLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMA AQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGF GSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNA QAQMYRLTLRTSKEPVSRHLCEL |
Sequence Similarities : | Belongs to the adaptor complexes large subunit family. |
Gene Name : | AP2A1 adaptor-related protein complex 2, alpha 1 subunit [ Homo sapiens ] |
Official Symbol : | AP2A1 |
Synonyms : | AP2A1; adaptor-related protein complex 2, alpha 1 subunit; ADTAA, CLAPA1; AP-2 complex subunit alpha-1; |
Gene ID : | 160 |
mRNA Refseq : | NM_014203 |
Protein Refseq : | NP_055018 |
MIM : | 601026 |
Uniprot ID : | O95782 |
Chromosome Location : | 19q13.3 |
Pathway : | Arf1 pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EGFR downregulation, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; |
Function : | protein C-terminus binding; protein binding; protein transporter activity; |
Products Types
◆ Recombinant Protein | ||
AP2A1-600M | Recombinant Mouse AP2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP2A1-175R | Recombinant Rhesus Macaque AP2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP2A1-185H | Recombinant Human AP2A1 Protein, His-tagged | +Inquiry |
AP2A1-347R | Recombinant Rhesus monkey AP2A1 Protein, His-tagged | +Inquiry |
AP2A1-1738M | Recombinant Mouse AP2A1 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (18)
Ask a questionThe AP2A1 has the function of regulating intracellular molecular transport, so it has potential application value in drug delivery, gene therapy and cancer therapy.
The study of AP2A1 is still in its infancy, but some interesting results have been achieved. Future studies will further explore its potential for clinical and scientific applications and improve its efficacy and safety.
AP2A1 has been widely used in neuroscience research to study the important processes of endocytosis, synaptic formation and synaptic plasticity of nerve cells.
The biosynthesis of AP2A1 is the process of synthesis into protein according to the encoded mRNA sequence by the cellular transcription and translation mechanism.
AP2A1 can inhibit the proliferation and metastasis of tumor cells and promote the apoptosis of tumor cells by regulating the signaling pathway, so as to achieve the purpose of anticancer.
AP2A1 can usually be synthesized in large quantities in the expressing host through genetic engineering technology, and then purified protein can be prepared through purification and structural identification.
The commonly used validation methods include intracellular localization, protein expression level detection and functional experimental proof.
At present, there are no clear studies showing a direct association between AP2A1 and cardiovascular disease, and further empirical studies are needed to explore.
AP2A1 can be used for high-throughput screening and gene function analysis in genetic studies to study the relationship between genes and phenotypes.
Studies have shown that recombinant AP2A1 protein may improve insulin sensitivity in diabetic patients by regulating pathways such as glucose transport, but relevant research is still in the early stages.
AP2A1 is not currently widely used in the treatment of infectious diseases, but researchers are exploring its potential vaccine and therapeutic value.
Studies have shown that recombinant AP2A1 protein may play a certain role in inhibiting the development of obesity by regulating molecular transport and metabolism in adipocytes.
The current study shows that the AP2A1 may have some potential in the treatment of neurodegenerative diseases, but more research is still needed to verify its true efficacy.
The role of AP2A1 in the signal transduction pathway is to participate in endocytosis, thereby regulating the interaction and signal transduction between intracellular molecules and membrane proteins.
No significant side effects of recombinant AP2A1 have been reported, but its safety needs to be carefully evaluated in application.
The recombinant AP2A1 protein may be relevant for immunotherapy because it can affect cellular endocytosis and antigen processing, which in turn affects immune cell function.
The recombinant AP2A1 protein can be used for stem cell differentiation and targeted induction to promote the production and maintenance of specific cell lines.
At present, there are no clear results showing that the AP2A1 can directly block tumor angiogenesis, but relevant studies are ongoing.
Customer Reviews (4)
Write a reviewThe short half-life and high clearance characteristics make it have greater potential in the treatment of tumors, infections and other diseases, and is expected to become a new generation of therapeutic drugs.
Stability is very high and it can maintain stable performance even in extreme environments, which shows its excellent adaptability and reliability.
Production process uses advanced biotechnology, which makes the production process more efficient and environmentally friendly, and has a positive impact on the environment.
Activity is very powerful and can effectively accelerate the process of chemical reactions, which brings great convenience to our experiments.
Ask a Question for All AP2A1 Products
Required fields are marked with *
My Review for All AP2A1 Products
Required fields are marked with *
Inquiry Basket