Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human AP2A1, His-tagged

Cat.No. : AP2A1-27357TH
Product Overview : Recombinant fragment, corresponding to amino acids 734-950 of Human AP2 alpha isoform B, with a N terminal His tag; predicted MWt 25kDa:
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined.
Conjugation : HIS
Source : E. coli
Tissue specificity : Isoform A expressed in forebrain, skeletal muscle, spinal cord, cerebellum, salivary gland, heart and colon. Isoform B is widely expressed in tissues and also in breast cancer and in prostate carcinoma cells.
Form : Lyophilised:Reconstitution with 45 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FENQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQNFSPTV VHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRD FLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMA AQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGF GSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNA QAQMYRLTLRTSKEPVSRHLCEL
Sequence Similarities : Belongs to the adaptor complexes large subunit family.
Gene Name : AP2A1 adaptor-related protein complex 2, alpha 1 subunit [ Homo sapiens ]
Official Symbol : AP2A1
Synonyms : AP2A1; adaptor-related protein complex 2, alpha 1 subunit; ADTAA, CLAPA1; AP-2 complex subunit alpha-1;
Gene ID : 160
mRNA Refseq : NM_014203
Protein Refseq : NP_055018
MIM : 601026
Uniprot ID : O95782
Chromosome Location : 19q13.3
Pathway : Arf1 pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EGFR downregulation, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem;
Function : protein C-terminus binding; protein binding; protein transporter activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (18)

Ask a question
What are the clinical applications of AP2A1 ? 11/21/2022

The AP2A1 has the function of regulating intracellular molecular transport, so it has potential application value in drug delivery, gene therapy and cancer therapy.

What is the research progress and prospect of AP2A1 ? 07/25/2022

The study of AP2A1 is still in its infancy, but some interesting results have been achieved. Future studies will further explore its potential for clinical and scientific applications and improve its efficacy and safety.

What is the important role of AP2A1 in neuroscience research? 09/05/2021

AP2A1 has been widely used in neuroscience research to study the important processes of endocytosis, synaptic formation and synaptic plasticity of nerve cells.

What is the biosynthesis mechanism of AP2A1 ? 07/10/2021

The biosynthesis of AP2A1 is the process of synthesis into protein according to the encoded mRNA sequence by the cellular transcription and translation mechanism.

What is the mechanism of action of AP2A1 in tumor therapy? 05/16/2021

AP2A1 can inhibit the proliferation and metastasis of tumor cells and promote the apoptosis of tumor cells by regulating the signaling pathway, so as to achieve the purpose of anticancer.

How to prepare AP2A1 ? 04/14/2021

AP2A1 can usually be synthesized in large quantities in the expressing host through genetic engineering technology, and then purified protein can be prepared through purification and structural identification.

How to verify the biological activity of AP2A1 ? 12/19/2020

The commonly used validation methods include intracellular localization, protein expression level detection and functional experimental proof.

Is there any relevant study that shows the relationship between AP2A1 and cardiovascular disease? 10/02/2020

At present, there are no clear studies showing a direct association between AP2A1 and cardiovascular disease, and further empirical studies are needed to explore.

What is the application of recombinant AP2A1 in genetic research? 08/17/2020

AP2A1 can be used for high-throughput screening and gene function analysis in genetic studies to study the relationship between genes and phenotypes.

Can AP2A1 improve insulin sensitivity in diabetic patients? 04/27/2020

Studies have shown that recombinant AP2A1 protein may improve insulin sensitivity in diabetic patients by regulating pathways such as glucose transport, but relevant research is still in the early stages.

Can AP2A1 be used as a vaccine or therapy to treat infectious diseases? 01/18/2020

AP2A1 is not currently widely used in the treatment of infectious diseases, but researchers are exploring its potential vaccine and therapeutic value.

What is the potential of recombinant AP2A1 in the treatment of obesity? 01/08/2020

Studies have shown that recombinant AP2A1 protein may play a certain role in inhibiting the development of obesity by regulating molecular transport and metabolism in adipocytes.

Can recombinant AP2A1 be used to treat neurodegenerative diseases? 11/27/2019

The current study shows that the AP2A1 may have some potential in the treatment of neurodegenerative diseases, but more research is still needed to verify its true efficacy.

What is the role of AP2A1 in the signaling pathway? 09/12/2019

The role of AP2A1 in the signal transduction pathway is to participate in endocytosis, thereby regulating the interaction and signal transduction between intracellular molecules and membrane proteins.

Are there side effects of AP2A1 ? 08/18/2019

No significant side effects of recombinant AP2A1 have been reported, but its safety needs to be carefully evaluated in application.

What is the relevance of recombinant AP2A1 protein to immunotherapy? 07/12/2019

The recombinant AP2A1 protein may be relevant for immunotherapy because it can affect cellular endocytosis and antigen processing, which in turn affects immune cell function.

What is the application of AP2A1 in stem cell research? 03/30/2019

The recombinant AP2A1 protein can be used for stem cell differentiation and targeted induction to promote the production and maintenance of specific cell lines.

Can AP2A1 be used to block tumor angiogenesis? 01/13/2019

At present, there are no clear results showing that the AP2A1 can directly block tumor angiogenesis, but relevant studies are ongoing.

Customer Reviews (4)

Write a review
Reviews
11/19/2022

    The short half-life and high clearance characteristics make it have greater potential in the treatment of tumors, infections and other diseases, and is expected to become a new generation of therapeutic drugs.

    02/04/2022

      Stability is very high and it can maintain stable performance even in extreme environments, which shows its excellent adaptability and reliability.

      11/21/2021

        Production process uses advanced biotechnology, which makes the production process more efficient and environmentally friendly, and has a positive impact on the environment.

        12/13/2019

          Activity is very powerful and can effectively accelerate the process of chemical reactions, which brings great convenience to our experiments.

          Ask a Question for All AP2A1 Products

          Required fields are marked with *

          My Review for All AP2A1 Products

          Required fields are marked with *

          0

          Inquiry Basket

          cartIcon
          logo

          FOLLOW US

          Terms and Conditions        Privacy Policy

          Copyright © 2024 Creative BioMart. All Rights Reserved.

          Contact Us

          • /

          Stay Updated on the Latest Bioscience Trends