Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human APEH, His-tagged

Cat.No. : APEH-26038TH
Product Overview : Recombinant fragment, corresponding to amino acids 560-732 of Human AARE with an N terminal His tag. mol wt: 21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 78 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQ YPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPF SSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQED RRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVE SDSFMNAVLWLRTHLGS
Gene Name : APEH N-acylaminoacyl-peptide hydrolase [ Homo sapiens ]
Official Symbol : APEH
Synonyms : APEH; N-acylaminoacyl-peptide hydrolase; D3F15S2, D3S48E, DNF15S2; acylamino-acid-releasing enzyme;
Gene ID : 327
mRNA Refseq : NM_001640
Protein Refseq : NP_001631
MIM : 102645
Uniprot ID : P13798
Chromosome Location : 3p21
Function : hydrolase activity; serine-type endopeptidase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
What are the side effects of APEH ? 11/08/2022

At present, the side effects of APEH are relatively limited, and further clinical and scientific studies are needed to evaluate them.

What is APEH ? 07/22/2022

APEH is a protein prepared by recombinant technology of human amino terminal hydrolase (APEH) gene.

What is the application of APEH in the treatment of neurological diseases? 01/14/2022

APEH may be used to treat nervous system diseases by regulating neuronal function and alleviating nervous system inflammation.

What is the safety and efficacy of APEH in clinical trials? 01/14/2022

At present, there are few clinical trial studies on APEH , and more data are needed to evaluate its safety and efficacy.

What is the relationship between APEH and tumor therapy? 12/15/2021

The APEH may affect the genesis and development of tumor by regulating the expression of tumor-related genes.

What is the preparation method of APEH ? 07/06/2021

The preparation of APEH is mainly accomplished through the steps of gene cloning, expression and purification.

What is the latest progress of APEH in preclinical research? 06/03/2021

The latest research indicates that the APEH may have potential application value in the treatment of tumor and nervous system diseases.

What are the biological functions of APEH ? 05/07/2021

APEH can participate in the biological processes of protein catabolism and amino acid release.

In what scientific research fields is APEH widely studied? 02/24/2020

The of APEH has been studied in biochemistry, molecular biology, pharmacology and other fields.

What is the clinical value of APEH ? 01/09/2020

APEH has potential clinical application value, and may play a role in the treatment of tumor and nervous system diseases.

Customer Reviews (4)

Write a review
Reviews
05/09/2022

    The green production process of APEH is very advanced and adopts the most environmentally friendly production technology, which is worthy of vigorous promotion.

    02/28/2022

      High clearance of APEH demonstrated its excellent pharmacokinetic characteristics and provided a new direction for biomedical research.

      03/11/2021

        Clear banding and no impurity interference, showing its excellent purity and specificity.

        06/09/2019

          Can maintain consistent performance every time it is used, which provides great convenience for experiments.

          Ask a Question for All APEH Products

          Required fields are marked with *

          My Review for All APEH Products

          Required fields are marked with *

          0

          Inquiry Basket

          cartIcon
          logo

          FOLLOW US

          Terms and Conditions        Privacy Policy

          Copyright © 2024 Creative BioMart. All Rights Reserved.

          Contact Us

          • /

          Stay Updated on the Latest Bioscience Trends