Recombinant Human APEH, His-tagged
Cat.No. : | APEH-26038TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 560-732 of Human AARE with an N terminal His tag. mol wt: 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 78 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQ YPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPF SSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQED RRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVE SDSFMNAVLWLRTHLGS |
Gene Name : | APEH N-acylaminoacyl-peptide hydrolase [ Homo sapiens ] |
Official Symbol : | APEH |
Synonyms : | APEH; N-acylaminoacyl-peptide hydrolase; D3F15S2, D3S48E, DNF15S2; acylamino-acid-releasing enzyme; |
Gene ID : | 327 |
mRNA Refseq : | NM_001640 |
Protein Refseq : | NP_001631 |
MIM : | 102645 |
Uniprot ID : | P13798 |
Chromosome Location : | 3p21 |
Function : | hydrolase activity; serine-type endopeptidase activity; |
Products Types
◆ Recombinant Protein | ||
APEH-181R | Recombinant Rhesus Macaque APEH Protein, His (Fc)-Avi-tagged | +Inquiry |
APEH-2527H | Recombinant Human APEH protein, His-tagged | +Inquiry |
APEH-352R | Recombinant Rhesus monkey APEH Protein, His-tagged | +Inquiry |
APEH-9860Z | Recombinant Zebrafish APEH | +Inquiry |
Apeh-3142R | Recombinant Rat Apeh, His-tagged | +Inquiry |
◆ Lysates | ||
APEH-8798HCL | Recombinant Human APEH 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionAt present, the side effects of APEH are relatively limited, and further clinical and scientific studies are needed to evaluate them.
APEH is a protein prepared by recombinant technology of human amino terminal hydrolase (APEH) gene.
APEH may be used to treat nervous system diseases by regulating neuronal function and alleviating nervous system inflammation.
At present, there are few clinical trial studies on APEH , and more data are needed to evaluate its safety and efficacy.
The APEH may affect the genesis and development of tumor by regulating the expression of tumor-related genes.
The preparation of APEH is mainly accomplished through the steps of gene cloning, expression and purification.
The latest research indicates that the APEH may have potential application value in the treatment of tumor and nervous system diseases.
APEH can participate in the biological processes of protein catabolism and amino acid release.
The of APEH has been studied in biochemistry, molecular biology, pharmacology and other fields.
APEH has potential clinical application value, and may play a role in the treatment of tumor and nervous system diseases.
Customer Reviews (4)
Write a reviewThe green production process of APEH is very advanced and adopts the most environmentally friendly production technology, which is worthy of vigorous promotion.
High clearance of APEH demonstrated its excellent pharmacokinetic characteristics and provided a new direction for biomedical research.
Clear banding and no impurity interference, showing its excellent purity and specificity.
Can maintain consistent performance every time it is used, which provides great convenience for experiments.
Ask a Question for All APEH Products
Required fields are marked with *
My Review for All APEH Products
Required fields are marked with *
Inquiry Basket