Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human APLP1, His-tagged

Cat.No. : APLP1-26119TH
Product Overview : Recombinant fragment, corresponding to amino acids 274-651 of Human APLP1 with an N-terminal His tag; Predicted MWt 43 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD).
Form : Lyophilised:Reconstitute with 58 μl aqua dest
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRA KMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALN EHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRR AALEGFLAALQADPPQAERVLLALRRYLRAEQKEQRHT LRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLL DQNPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSE DKGGLQPPDSKDADTPMTLPKGSTEQDAASPEKEKMNP LEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSRE AVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVD PMLTLEEQQLRELQRHGYENPTYRFLEERP
Sequence Similarities : Belongs to the APP family.
Gene Name : APLP1 amyloid beta (A4) precursor-like protein 1 [ Homo sapiens ]
Official Symbol : APLP1
Synonyms : APLP1; amyloid beta (A4) precursor-like protein 1; amyloid-like protein 1; amyloid precursor like protein 1; amyloid like protein 1; APLP;
Gene ID : 333
mRNA Refseq : NM_001024807
Protein Refseq : NP_001019978
MIM : 104775
Uniprot ID : P51693
Chromosome Location : 19q
Function : alpha-2A adrenergic receptor binding; alpha-2B adrenergic receptor binding; alpha-2C adrenergic receptor binding; heparin binding; identical protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (20)

Ask a question
Can recombinant APLP1 be used in the treatment of neurodegenerative diseases? 12/28/2022

APLP1 is considered as one of the therapeutic directions for neurodegenerative diseases, and related research and development is ongoing.

What is the relationship between APLP1 and the formation of neuronal axons? 12/13/2022

APLP1 is closely related to the formation of neuronal axons, which can regulate the formation and development of neuronal axons.

What role does APLP1 play in synaptic plasticity? 11/13/2022

APLP1 plays an important role in synaptic plasticity, regulating the formation and plasticity of synapses.

What is the relationship between APLP1 and Alzheimer's disease? 09/24/2022

Studies have shown that APLP1 is associated with Alzheimer's disease and may be one of the triggers of Alzheimer's disease.

What is the relationship between APLP1 and beta-amyloid protein? 07/24/2022

APLP1 is related to beta-amyloid protein, which is one of the main components of beta-amyloid substances.

What is the physiological function of APLP1 ? 06/22/2022

The physiological functions of APLP1 include cell signaling, neuronal development, neuronal protection, metabolic regulation and so on.

Is the genetic mutation of APLP1 associated with certain diseases? 06/19/2022

Mutations in the APLP1 are associated with a variety of diseases, including cancer and neurological disorders.

What is the relationship between APLP1 and synaptic repair? 01/23/2022

APLP1 is associated with the repair of neuronal synapses and can promote the reconstruction and repair of neuronal synapses.

Can APLP1 be used as a target for drug development? 01/20/2022

It can be used as a target for drug development, and drug studies targeting APLP1 are ongoing.

What kind of diseases can APLP1 be used to treat? 01/11/2022

APLP1 can be used in the treatment of neurodegenerative diseases, stroke, metabolic diseases and other aspects.

What is the role of APLP1 in cell signaling? 11/26/2021

APLP1 plays an important role in cell signaling and can participate in a series of biological processes such as cell proliferation, apoptosis and differentiation.

What is the relationship between APLP1 and neuron cell membrane? 10/10/2021

APLP1 can participate in the formation and stability of neuron cell membrane, and plays an important role in the development and maintenance of cell membrane.

In what fields does APLP1 have application prospects? 12/26/2020

APLP1 can be applied to neurodegenerative diseases, cancer, and metabolic diseases.

Does APLP1 affect cognition and learning ability? 11/24/2020

Some studies suggest that APLP1 may have an effect on memory and learning ability.

What is the relationship between APLP1 and cancer? 09/18/2020

APLP1 has been found to be associated with a variety of cancers, and it may serve as a cancer marker or therapeutic target.

What are the antioxidant properties of APLP1 ? 08/13/2020

APLP1 can play an antioxidant role by inhibiting the generation of free radicals and regulating the activity of antioxidant enzymes.

What is the role of APLP1 in inflammatory response? 03/24/2020

APLP1 plays an important biological role in inflammatory response, and studies have shown that it can be involved in regulating the body's immune response and cytokine play.

What are the preparation methods of APLP1 ? 01/07/2020

The preparation methods of APLP1 include genetic engineering technology, cell culture technology, etc.

What are the effects of APLP1 on adult nerve cells? 12/08/2019

Studies have shown that APLP1 can improve the living environment of adult nerve cells and protect nerve cells from damage.

What is the role of APLP1 in nerve cells? 05/21/2019

Studies have shown that APLP1 plays an important role in the development and protection of neurons and can prevent neuronal apoptosis.

Customer Reviews (4)

Write a review
Reviews
12/12/2022

    Labeling effect in Western blot is very good, and operations such as fluorescent labeling can be performed to facilitate subsequent detection and analysis.

    06/05/2022

      Production process of APLP1 pays attention to harmonious coexistence with nature, and realizes zero pollution in the production process, demonstrating its persistent pursuit of environmental protection.

      06/23/2020

        The same batch of experiments are very similar, and the reproducibility is very high.

        05/05/2020

          Preparation process is strictly controlled to ensure the quality and safety of the product.

          Ask a Question for All APLP1 Products

          Required fields are marked with *

          My Review for All APLP1 Products

          Required fields are marked with *

          0

          Inquiry Basket

          cartIcon
          logo

          FOLLOW US

          Terms and Conditions        Privacy Policy

          Copyright © 2024 Creative BioMart. All Rights Reserved.

          Contact Us

          • /

          Stay Updated on the Latest Bioscience Trends