Recombinant Human APOF
Cat.No. : | APOF-27294TH |
Product Overview : | Recombinant full length Human Apolipoprotein F with N terminal proprietary tag; Predicted MWt 58.01 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The product of this gene is one of the minor apolipoproteins found in plasma. This protein forms complexes with lipoproteins and may be involved in transport and/or esterification of cholesterol. |
Protein length : | 291 amino acids |
Molecular Weight : | 58.010kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed by the liver and secreted in plasma. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGF SHMAPLPKFLVSLALRNDALEEAGCQADVWALQLQLYRQG GVNATQVLIQHLRGLQKGRSTERNVSVEALASALQLLARE QQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNL GTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTK EGLRAISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSY DLDPGAGSLEI |
Gene Name : | APOF apolipoprotein F [ Homo sapiens ] |
Official Symbol : | APOF |
Synonyms : | APOF; apolipoprotein F; |
Gene ID : | 319 |
mRNA Refseq : | NM_001638 |
Protein Refseq : | NP_001629 |
Uniprot ID : | Q13790 |
Chromosome Location : | 12q13 |
Function : | cholesterol binding; lipid transporter activity; receptor binding; |
Products Types
◆ Recombinant Protein | ||
APOF-639M | Recombinant Mouse APOF Protein, His (Fc)-Avi-tagged | +Inquiry |
APOF-383R | Recombinant Rat APOF Protein, His (Fc)-Avi-tagged | +Inquiry |
Apof-229R | Recombinant Rat Apof Protein, His-tagged | +Inquiry |
APOF-709H | Recombinant Human APOF protein, GST-tagged | +Inquiry |
APOF-0306H | Recombinant Human APOF Protein (Val122-Trp307), N-His-tagged | +Inquiry |
◆ Lysates | ||
APOF-8779HCL | Recombinant Human APOF 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (20)
Ask a questionYes, APOF protein levels can be measured in the blood using various laboratory techniques such as enzyme-linked immunosorbent assay (ELISA) or mass spectrometry. These tests provide information about the concentration of APOF protein in circulation.
Researchers study the APOF protein using various techniques, including protein isolation and purification, genetic analysis, animal models, and cell culture experiments. These approaches help in understanding the protein's structure, function, and how it is involved in lipid metabolism.
Yes, APOF protein is known to interact with several other proteins involved in lipid metabolism. For example, it binds to lipoprotein receptors, lipases, and lipid transfer proteins, facilitating the transport and metabolism of lipids.
Yes, certain genetic variations in the APOF gene have been identified that affect protein function and may impact lipid metabolism. These variations are being studied for their potential association with cardiovascular diseases.
Apart from its role in lipoprotein lipase activation, APOF protein is thought to be involved in the regulation of fatty acid and triglyceride metabolism, as well as cholesterol efflux and reverse cholesterol transport.
Currently, there are no specific drugs or interventions that directly target the APOF protein. However, the modulation of APOF function and lipid metabolism is often targeted through other approaches, such as statin medications for managing dyslipidemia.
APOF protein is involved in the regulation of lipid metabolism, including cholesterol transport. Altered levels or functionality of APOF may contribute to dyslipidemia, a known risk factor for cardiovascular diseases such as atherosclerosis and coronary heart disease.
Currently, there is limited evidence to suggest that APOF protein can be used as a specific biomarker for any particular disease or disorder. However, ongoing research is exploring its potential as a biomarker for dyslipidemia and cardiovascular risk.
Diet plays a crucial role in lipid metabolism, and certain dietary components, such as fats and cholesterol, can influence the expression and function of APOF protein. High-fat diets, for instance, can alter APOF gene expression and affect lipid metabolism.
Targeting the APOF protein has potential therapeutic implications for conditions involving dyslipidemia and cardiovascular diseases. By modulating APOF function, it may be possible to regulate lipid metabolism and promote healthy lipid profiles.
The liver is the primary site of APOF protein synthesis. However, other tissues, such as the small intestine and adipose tissue, also produce lower amounts of APOF. The liver remains the major contributor to circulating APOF levels.
Currently, no specific disorders or diseases have been directly linked to APOF protein mutations or deficiencies. However, further research may uncover potential associations with specific conditions related to lipid metabolism and cardiovascular health.
While the primary function of APOF protein lies in lipid metabolism, there is emerging evidence suggesting its potential involvement in neuroinflammatory processes and neurodegenerative disorders, such as Alzheimer's disease. However, more research is needed to elucidate these relationships.
Targeting the APOF protein directly for therapeutic interventions is still being studied. However, its involvement in lipid metabolism and potential association with cardiovascular diseases make it an attractive target for future therapeutic strategies.
While the exact role of APOF protein in immune response and inflammation is not fully understood, there is evidence suggesting its involvement in modulating inflammatory processes. It may play a role in regulating cytokine production and immune cell function.
APOF protein is part of high-density lipoprotein (HDL), commonly referred to as the "good" cholesterol. HDL helps remove excess cholesterol from the bloodstream and transports it back to the liver for disposal.
Yes, genetic mutations and variations in the APOF gene have been identified. For example, certain single nucleotide polymorphisms (SNPs) in the APOF gene have been associated with altered lipid profiles and increased risk of cardiovascular diseases.
The APOF protein is synthesized in the liver, where it is produced as a precursor protein called pre-apo F. This precursor undergoes post-translational modifications, including cleavage and lipidation, to form the mature APOF protein.
As of now, there haven't been any specific APOF protein deficiencies or dysfunctions identified. However, further research may uncover potential associations between APOF dysfunction and certain diseases or conditions.
While research is ongoing, the APOF protein has shown potential as a therapeutic target for managing dyslipidemia and related cardiovascular diseases. Developing drugs that modulate APOF function could potentially help regulate lipid metabolism and mitigate the risk of cardiovascular complications.
Customer Reviews (4)
Write a reviewThe technical support provided by the manufacturer is invaluable in resolving any potential roadblocks and optimizing the utilization of APOF protein.
With their assistance, I am confident in overcoming challenges, producing robust results, and advancing our understanding of APOF protein and its biological significance.
In addition to the impeccable protein quality, the manufacturer provides excellent technical support that can effectively address any challenges I may encounter during my experiments.
This reliable supply chain management assures that I have uninterrupted access to the protein, allowing me to plan and conduct my experiments without concern for availability issues.
Ask a Question for All APOF Products
Required fields are marked with *
My Review for All APOF Products
Required fields are marked with *
Inquiry Basket