Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human APP protein(672-711 aa)

Cat.No. : APP-2551H
Product Overview : Recombinant Human APP protein(P05067)(672-711 aa) was synthesized.
  • Specification
  • Gene Information
  • Related Products
Source : Others
Species : Human
Tag : tag free
Protein length : 672-711 aa
Form : The polypeptide was dissolved in DMSO
Molecular Mass : 4.5 kDa
AASequence : YEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name : APP amyloid beta (A4) precursor protein [ Homo sapiens ]
Official Symbol : APP
Synonyms : APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma;
Gene ID : 351
mRNA Refseq : NM_000484
Protein Refseq : NP_000475
MIM : 104760
UniProt ID : P05067

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends