Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human AQP8

Cat.No. : AQP8-26532TH
Product Overview : Recombinant full length Human Aquaporin 8 with N terminal proprietary tag; Predicted MWt 54.16 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0).Aquaporin 8 mRNA is found in pancreas and colon but not other tissues.
Protein length : 255 amino acids
Molecular Weight : 54.160kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed only in pancreas and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSA LFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNI SGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAA LAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTT LLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSG GCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIR CFIGDGKTRLILKAR
Sequence Similarities : Belongs to the MIP/aquaporin (TC 1.A.8) family.
Gene Name : AQP8 aquaporin 8 [ Homo sapiens ]
Official Symbol : AQP8
Synonyms : AQP8; aquaporin 8; aquaporin-8;
Gene ID : 343
mRNA Refseq : NM_001169
Protein Refseq : NP_001160
MIM : 603750
Uniprot ID : O94778
Chromosome Location : 16p12
Pathway : Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function : transporter activity; water channel activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (26)

Ask a question
Are there any known drugs that target AQP8? 02/16/2023

Currently, there are no approved drugs that directly target AQP8. However, researchers are actively studying and exploring the potential of AQP8 as a therapeutic target. Some studies have investigated the use of compounds that modulate AQP8 activity as potential treatments for certain liver diseases.

Can AQP8 play a role in drug transport or drug resistance? 09/13/2022

There is limited evidence suggesting that AQP8 may play a role in drug transport and drug resistance. Some studies have proposed that AQP8 could potentially affect the uptake or efflux of certain drugs, impacting their efficacy or resistance. However, further research is needed to fully understand the implications of AQP8 in drug pharmacokinetics and resistance mechanisms.

Can AQP8 play a role in drug transport or drug resistance? 09/13/2022

There is limited evidence suggesting that AQP8 may play a role in drug transport and drug resistance. Some studies have proposed that AQP8 could potentially affect the uptake or efflux of certain drugs, impacting their efficacy or resistance. However, further research is needed to fully understand the implications of AQP8 in drug pharmacokinetics and resistance mechanisms.

Can AQP8 be used as a biomarker for certain diseases? 07/12/2022

While AQP8 shows promise as a potential biomarker for certain diseases, more research is needed to establish its clinical utility. Studies have suggested that altered AQP8 expression may be associated with liver diseases, digestive disorders, and some cancers. However, further investigation is required to determine its diagnostic or prognostic value in clinical settings.

Can AQP8 be used as a biomarker for certain diseases? 07/12/2022

While AQP8 shows promise as a potential biomarker for certain diseases, more research is needed to establish its clinical utility. Studies have suggested that altered AQP8 expression may be associated with liver diseases, digestive disorders, and some cancers. However, further investigation is required to determine its diagnostic or prognostic value in clinical settings.

Can changes in AQP8 expression or activity contribute to cancer development? 06/25/2022

There is evidence suggesting that alterations in AQP8 expression or function may be implicated in cancer development. Studies have reported changes in AQP8 levels in various types of tumors, including hepatocellular carcinoma, colon cancer, and pancreatic cancer. Further research is being conducted to unravel the precise role of AQP8 in tumorigenesis and its potential as a therapeutic target.

Is AQP8 expressed in the central nervous system? 12/11/2021

Yes, AQP8 has been found to be expressed in the central nervous system, including regions such as the brain and spinal cord. It is involved in the regulation of water movement across brain cells and plays a role in maintaining brain homeostasis.

Is AQP8 expressed in the central nervous system? 12/11/2021

Yes, AQP8 has been found to be expressed in the central nervous system, including regions such as the brain and spinal cord. It is involved in the regulation of water movement across brain cells and plays a role in maintaining brain homeostasis.

What are the implications of AQP8 dysfunction? 08/21/2020

AQP8 dysfunction has been associated with various health conditions. For example, in the liver, altered AQP8 expression has been linked to liver cirrhosis, cholestasis, and non-alcoholic fatty liver disease. In the digestive tract, changes in AQP8 expression have been observed in inflammatory bowel disease and diarrhea. Understanding the role of AQP8 in these conditions may provide insights for potential therapeutic interventions.

Are there any known inhibitors or activators of AQP8? 07/03/2020

While there are no specific inhibitors or activators of AQP8 currently approved for clinical use, researchers are actively studying compounds that could modulate its activity. These studies aim to identify potential therapeutic targets for conditions related to AQP8 dysregulation.

How is AQP8 expression regulated in the gastrointestinal tract? 04/18/2020

The regulation of AQP8 expression in the gastrointestinal tract is complex and not fully understood. Multiple factors, such as hormones, cytokines, and dietary components, may influence its expression. For example, bile acids have been shown to upregulate AQP8 expression in the liver and small intestine.

How is AQP8 expression regulated in the gastrointestinal tract? 04/18/2020

The regulation of AQP8 expression in the gastrointestinal tract is complex and not fully understood. Multiple factors, such as hormones, cytokines, and dietary components, may influence its expression. For example, bile acids have been shown to upregulate AQP8 expression in the liver and small intestine.

Can AQP8 be targeted for therapeutic purposes? 12/10/2019

AQP8 is being explored as a potential therapeutic target for various diseases. Researchers are investigating the development of drugs that can modulate AQP8 activity, particularly in liver diseases and certain cancers. Inhibition or activation of AQP8 could potentially be used to manage fluid balance disorders, liver diseases, and other conditions.

Can AQP8 be targeted for therapeutic purposes? 12/10/2019

AQP8 is being explored as a potential therapeutic target for various diseases. Researchers are investigating the development of drugs that can modulate AQP8 activity, particularly in liver diseases and certain cancers. Inhibition or activation of AQP8 could potentially be used to manage fluid balance disorders, liver diseases, and other conditions.

Is there any relationship between AQP8 expression and obesity? 05/17/2019

Some studies have suggested a potential link between AQP8 expression and obesity. Alterations in AQP8 levels have been reported in adipose tissue of obese individuals. Further research is needed to ascertain the precise role and mechanisms through which AQP8 may contribute to obesity and related metabolic disorders.

Is there any relationship between AQP8 expression and obesity? 05/17/2019

Some studies have suggested a potential link between AQP8 expression and obesity. Alterations in AQP8 levels have been reported in adipose tissue of obese individuals. Further research is needed to ascertain the precise role and mechanisms through which AQP8 may contribute to obesity and related metabolic disorders.

Are there any diseases or conditions associated with AQP8 dysfunction? 08/23/2018

While more research is needed, studies have implicated AQP8 dysfunction in various diseases and conditions. For example, altered expression or activity of AQP8 has been linked to liver diseases, such as non-alcoholic fatty liver disease (NAFLD) and liver fibrosis. Changes in AQP8 expression have also been observed in digestive disorders, including inflammatory bowel disease (IBD) and ulcerative colitis.

Are there any diseases or conditions associated with AQP8 dysfunction? 08/23/2018

While more research is needed, studies have implicated AQP8 dysfunction in various diseases and conditions. For example, altered expression or activity of AQP8 has been linked to liver diseases, such as non-alcoholic fatty liver disease (NAFLD) and liver fibrosis. Changes in AQP8 expression have also been observed in digestive disorders, including inflammatory bowel disease (IBD) and ulcerative colitis.

Is AQP8 involved in any physiological processes other than water transport? 02/09/2018

Yes, besides its role in water transport, AQP8 has been implicated in several other physiological processes. For example, it is involved in the transport of glycerol, which is important for energy metabolism. AQP8 has also been shown to facilitate hydrogen peroxide transport, potentially impacting oxidative stress responses within the cell.

Does AQP8 play a role in kidney function? 01/25/2018

Yes, AQP8 is expressed in the kidney and has been implicated in water reabsorption in the renal tubules. It plays a role in maintaining water balance and urinary concentration. AQP8 function in the kidney is essential for proper kidney function and fluid homeostasis.

Does AQP8 play a role in kidney function? 01/25/2018

Yes, AQP8 is expressed in the kidney and has been implicated in water reabsorption in the renal tubules. It plays a role in maintaining water balance and urinary concentration. AQP8 function in the kidney is essential for proper kidney function and fluid homeostasis.

Does AQP8 have any other functions besides water transport? 05/27/2017

Although AQP8 is primarily known for its role as a water channel, studies have suggested its involvement in the transport of other small solutes, such as glycerol and hydrogen peroxide. However, more research is needed to fully understand these additional functions.

Is there any ongoing research on AQP8? 04/26/2017

Yes, ongoing research continues to explore the role of AQP8 in various physiological and pathological contexts. Scientists are investigating its involvement in liver diseases, digestive disorders, and metabolic regulation, among other areas of interest. These studies aim to deepen our understanding of AQP8's functions and potential therapeutic applications.

Are there any animal models available to study AQP8 function and regulation? 10/18/2016

Yes, animal models, such as mice, have been used to study AQP8 function and regulation. Knockout mouse models lacking the AQP8 gene have been developed to investigate its physiological roles. These models have provided insights into the impact of AQP8 deficiency on various organs and systems.

Are there any animal models available to study AQP8 function and regulation? 10/18/2016

Yes, animal models, such as mice, have been used to study AQP8 function and regulation. Knockout mouse models lacking the AQP8 gene have been developed to investigate its physiological roles. These models have provided insights into the impact of AQP8 deficiency on various organs and systems.

Are there any known genetic mutations associated with AQP8? 01/27/2016

Yes, certain genetic mutations in the AQP8 gene have been identified and associated with specific disorders. For instance, a mutation in AQP8 has been linked to primary male infertility, affecting sperm motility and function. These genetic abnormalities contribute to our understanding of AQP8's importance in reproductive processes.

Customer Reviews (8)

Write a review
Reviews
12/11/2022

    The reliable performance of the AQP8 protein in ELISA and its compatibility with protein electron microscopy structure analysis make it an excellent choice for a wide range of research studies.

    08/26/2022

      AQP8 protein is highly recommended for scientific research applications, especially in ELISA assays and protein electron microscopy structure analysis.

      08/08/2022

        AQP8 protein has proven to be instrumental in protein electron microscopy structure analysis.

        08/10/2021

          With AQP8 protein, researchers can visualize protein complexes and their interactions with remarkable clarity, unraveling important insights into their functional mechanisms.

          08/01/2020

            The AQP8 protein comes highly recommended for its excellent performance in various research applications.

            02/28/2020

              Researchers can confidently rely on its capabilities to generate precise and significant results, enhancing the understanding of protein function and dynamics.

              06/29/2018

                Its reliable and accurate performance ensures dependable results, contributing to the advancement of scientific knowledge in various fields of study.

                04/09/2016

                  This protein demonstrates exceptional performance in ELISA, delivering accurate and reliable results in the detection and quantification of specific antigens.

                  Ask a Question for All AQP8 Products

                  Required fields are marked with *

                  My Review for All AQP8 Products

                  Required fields are marked with *

                  0

                  Inquiry Basket

                  cartIcon
                  logo

                  FOLLOW US

                  Terms and Conditions        Privacy Policy

                  Copyright © 2024 Creative BioMart. All Rights Reserved.

                  Contact Us

                  • /

                  Stay Updated on the Latest Bioscience Trends