Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ARHGDIA, His-tagged

Cat.No. : ARHGDIA-30981TH
Product Overview : Recombinant fragment, corresponding to amino acids 6-204 of Human RhoGDI with an N terminal His tag; MWt 25kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 156 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDD ESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAP GPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNRE IVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFL TPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIK KDWKD
Sequence Similarities : Belongs to the Rho GDI family.
Gene Name : ARHGDIA Rho GDP dissociation inhibitor (GDI) alpha [ Homo sapiens ]
Official Symbol : ARHGDIA
Synonyms : ARHGDIA; Rho GDP dissociation inhibitor (GDI) alpha; GDIA1; rho GDP-dissociation inhibitor 1; RHOGDI;
Gene ID : 396
mRNA Refseq : NM_001185077
Protein Refseq : NP_001172006
MIM : 601925
Uniprot ID : P52565
Chromosome Location : 17q25.3
Pathway : Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem;
Function : GTPase activator activity; Rho GDP-dissociation inhibitor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (9)

Ask a question
What research is being conducted on ARHGDIA? 04/12/2022

Current research on ARHGDIA focuses on elucidating its role in various cellular processes and disease mechanisms. Scientists are investigating its involvement in cancer progression, metastasis, and therapeutic targeting potential. Additionally, studies are exploring the molecular mechanisms of ARHGDIA regulation and its interactions with other proteins and signaling pathways.

Are there any known diseases associated with dysregulation of ARHGDIA? 09/04/2021

Yes, alterations in ARHGDIA expression or mutations in the ARHGDIA gene have been linked to certain diseases. In addition to neutrophil-specific granule deficiency (SGD), mentioned earlier, dysregulation of ARHGDIA has been observed in certain cancers, such as breast cancer and colorectal cancer. Abnormal ARHGDIA expression has also been associated with blood disorders and cardiovascular diseases.

Are there any potential therapeutic strategies targeting ARHGDIA? 08/17/2019

Yes, targeting ARHGDIA has been explored as a potential therapeutic strategy in different diseases. For example, in cancer, inhibitors of Rho GTPases or RhoGEFs that interact with ARHGDIA have been investigated as potential anti-cancer agents. By inhibiting the activation of Rho GTPases, these compounds aim to disrupt signaling pathways involved in cancer progression and metastasis. Additionally, gene therapy approaches to modulate ARHGDIA expression levels have been explored as potential therapeutic interventions, particularly in diseases like neutrophil-specific granule deficiency.

Can changes in ARHGDIA expression levels be used as a diagnostic or prognostic marker? 11/02/2018

There is emerging evidence suggesting that ARHGDIA expression levels may have diagnostic or prognostic value in certain diseases, particularly cancer. Alterations in ARHGDIA expression have been associated with tumor grade, metastatic potential, and patient survival outcomes in some studies. However, further research and validation are required before it can be considered a reliable clinical marker.

Is ARHGDIA involved in neural development or neurological disorders? 09/11/2018

There is limited evidence suggesting the involvement of ARHGDIA in neural development and neurological disorders. Recent studies have found that ARHGDIA is expressed in the nervous system and may play a role in neuronal migration and axon guidance. However, further research is needed to fully understand its specific contributions to neural development and its potential involvement in neurological disorders.

Are there any animal models available to study ARHGDIA? 07/24/2018

Yes, several animal models have been developed to study the function and roles of ARHGDIA. Knockout mouse models lacking ARHGDIA expression have been generated, allowing researchers to investigate the impact of ARHGDIA deficiency in various tissues and organs. These models have provided valuable insights into the physiological and pathological roles of ARHGDIA in different systems.

Are there any known interactions of ARHGDIA with other proteins or molecules? 03/05/2018

Yes, ARHGDIA interacts with several proteins and molecules. It binds to Rho GTPases, specifically to their active GTP-bound form, preventing their activation. ARHGDIA also interacts with other regulatory proteins, such as Rho guanine nucleotide exchange factors (RhoGEFs) and Rho GTPase activating proteins (RhoGAPs), to modulate Rho GTPase activity. Additionally, ARHGDIA has been reported to interact with cytoskeletal proteins and participate in the regulation of actin dynamics.

Are there any known mutations or genetic variations in the ARHGDIA gene? 08/16/2017

Yes, various mutations and genetic variations in the ARHGDIA gene have been identified. Some mutations can result in altered protein function, leading to diseases or developmental disorders. For example, a specific mutation in the ARHGDIA gene has been associated with a rare genetic disorder called neutrophil-specific granule deficiency (SGD), characterized by impaired neutrophil function.

Can ARHGDIA be targeted for therapeutic purposes? 03/08/2016

The dysregulation of ARHGDIA in diseases, particularly cancer, suggests it could be a potential therapeutic target. Strategies to modulate ARHGDIA expression or activity may help regulate Rho GTPase signaling, leading to potential therapeutic benefits in cancer treatment. However, more research is needed to fully understand the therapeutic potential and feasibility of targeting ARHGDIA.

Customer Reviews (8)

Write a review
Reviews
12/20/2020

    the ARHGDIA protein is an exceptional tool for investigating the intricate mechanisms and pathogenesis of amyloid-related diseases.

    02/06/2020

      Their profound knowledge and expertise will undoubtedly help me overcome any challenges that arise, and their prompt assistance ensures a seamless progression of my research.

      07/08/2019

        the exemplary technical support provided by the manufacturer adds immense value to my experience.

        03/15/2018

          If needed, the availability of bulk purchase options further optimizes resource allocation, enabling me to conduct extensive experiments without compromising on quality.

          01/14/2018

            I am confident that their expertise and prompt assistance can help resolve any challenges I may encounter along the way.

            11/18/2017

              the ARHGDIA protein's exceptional quality, coupled with the manufacturer's outstanding technical support, ensures that it fulfills my experimental needs with utmost precision and efficacy.

              07/09/2017

                Their collaboration during trial design and data analysis enhances the reliability and significance of my research findings.

                05/25/2016

                  Whether it's troubleshooting experimental hurdles or optimizing protocols, their dedicated team is there to guide me, ensuring smooth progress and successful outcomes.

                  Ask a Question for All ARHGDIA Products

                  Required fields are marked with *

                  My Review for All ARHGDIA Products

                  Required fields are marked with *

                  0

                  Inquiry Basket

                  cartIcon
                  logo

                  FOLLOW US

                  Terms and Conditions        Privacy Policy

                  Copyright © 2024 Creative BioMart. All Rights Reserved.

                  Contact Us

                  • /

                  Stay Updated on the Latest Bioscience Trends