Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ARHGDIG

Cat.No. : ARHGDIG-26234TH
Product Overview : Recombinant full length Human ARHGDIG with N-terminal proprietary tag. Predicted MW 50.86 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843).
Protein length : 225 amino acids
Molecular Weight : 50.860kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Primarily expressed in pancreas and brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEV LDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPL PPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRV DKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD
Sequence Similarities : Belongs to the Rho GDI family.
Gene Name : ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ]
Official Symbol : ARHGDIG
Synonyms : ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3;
Gene ID : 398
mRNA Refseq : NM_001176
Protein Refseq : NP_001167
MIM : 602844
Uniprot ID : Q99819
Chromosome Location : 16p13.3
Pathway : G13 Signaling Pathway, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function : GTPase activator activity; Rho GDP-dissociation inhibitor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (33)

Ask a question
Are there any functional studies investigating the downstream effects of ARHGDIG on cellular signaling pathways? 01/21/2023

Currently, there are limited functional studies investigating the downstream effects of ARHGDIG on cellular signaling pathways. Future research is needed to elucidate the specific signaling pathways influenced by ARHGDIG and how it modulates cellular responses.

Is the expression of ARHGDIG gene altered in any pathological conditions? 12/06/2022

The alteration of ARHGDIG gene expression in pathological conditions has not been extensively studied. However, some studies have reported differential expression levels in specific disease contexts, suggesting a potential association with certain pathological conditions. Further research is needed to fully understand the expression patterns and potential implications of ARHGDIG in various diseases.

What are the potential downstream signaling pathways regulated by ARHGDIG protein? 10/20/2022

The exact downstream signaling pathways regulated by ARHGDIG protein are not yet fully elucidated. However, since it interacts with Rho GTPases, which are involved in numerous cellular processes, it is likely that ARHGDIG protein influences various downstream signaling pathways related to cell migration, adhesion, and cytoskeletal dynamics.

Does ARHGDIG protein have any known isoforms or splice variants? 09/30/2022

There is limited information available regarding isoforms or splice variants of ARHGDIG protein. Further research is needed to determine if any exist and if they contribute to functional diversity.

Is there any evidence suggesting a role for ARHGDIG in cancer development or progression? 06/11/2022

As of now, there is limited evidence suggesting the involvement of ARHGDIG in cancer development or progression. However, future studies exploring its expression and function in various cancer types may shed light on its potential role in oncogenesis or tumor progression.

Are there any known post-translational modifications of ARHGDIG protein? 12/04/2021

Presently, there is limited information regarding post-translational modifications of ARHGDIG protein. Future studies focusing on protein modifications such as phosphorylation, acetylation, or ubiquitination may provide insights into its regulation and functions.

Can ARHGDIG gene expression be influenced by environmental factors or stimuli? 03/14/2021

The impact of environmental factors or stimuli on ARHGDIG gene expression has not been extensively investigated. However, it is plausible that certain environmental cues or stimuli could modulate its expression, considering the potential involvement of ARHGDIG in cellular responses to extracellular signals.

Can targeting ARHGDIG protein have therapeutic implications? 02/22/2021

The therapeutic potential of targeting ARHGDIG protein is uncertain due to limited knowledge about its function and involvement in diseases. Further research is essential to determine if it can be a viable therapeutic target for specific conditions.

Can dysregulation of ARHGDIG protein contribute to cancer or other diseases? 11/16/2020

The potential involvement of ARHGDIG protein dysregulation in diseases is currently unknown. However, aberrant regulation of proteins involved in Rho GTPase signaling, such as ARHGDIG, has been implicated in various diseases. Further investigations are required to determine if ARHGDIG dysregulation contributes to specific disease processes.

Is ARHGDIG protein conserved across different species? 07/31/2020

ARHGDIG protein is conserved across various species, including humans, mice, and other mammals. This suggests that it likely plays a fundamental role in cellular processes.

Is there any ongoing research focused on ARHGDIG protein? 06/14/2020

As of now, limited research has been conducted on ARHGDIG protein. However, ongoing studies are likely exploring its function, interactions, and potential roles in cellular processes and disease pathways.

Is the expression of the ARHGDIG gene tissue-specific? 05/07/2020

The tissue-specific expression pattern of the ARHGDIG gene has not been extensively studied. However, some studies have reported differential expression levels in various tissues, suggesting a potential tissue-specific regulation. Further research is needed to fully understand the tissue-specific expression of ARHGDIG and its potential implications.

Is ARHGDIG gene expression regulated by any specific transcription factors? 05/01/2020

The regulatory mechanisms of ARHGDIG gene expression are not well understood, and specific transcription factors that directly regulate its expression have not been identified. Further studies investigating the transcriptional regulation of the ARHGDIG gene are needed to delineate the underlying mechanisms.

Are there any animal models available for studying the function of the ARHGDIG gene? 02/08/2020

Currently, there are no specific animal models available for studying the function of the ARHGDIG gene. Developing animal models, such as knockout or knockdown mice, may be useful in investigating the physiological roles of ARHGDIG and its potential implications in disease.

Can the ARHGDIG gene influence immune response or inflammation? 01/18/2020

The exact role of the ARHGDIG gene in immune response or inflammation is not well understood. However, since Rho GTPases, which are regulated by ARHGDIG, play important roles in immune cell function and inflammation, it is possible that ARHGDIG may indirectly influence immune response or inflammation through its regulation of Rho GTPases.

Can ARHGDIG protein be used as a biomarker for any diseases? 12/08/2019

At present, there is no evidence to suggest that ARHGDIG protein can be used as a biomarker for any specific diseases. Further studies are necessary to explore its potential as a diagnostic or prognostic biomarker in different pathological conditions.

Is the ARHGDIG protein predominantly localized in a specific cellular compartment? 11/01/2019

ARHGDIG protein is primarily localized in the cytoplasm, where it interacts with Rho GTPases to regulate their activity and localization. However, it's possible that the protein may have additional subcellular localizations that are yet to be discovered.

Does the expression of ARHGDIG protein vary in different tissues or cell types? 08/25/2019

The expression of ARHGDIG protein may vary in different tissues and cell types. Some studies have shown differential expression levels in specific tissues, indicating potential tissue specificity in its function.

Are there any known drugs or compounds targeted towards ARHGDIG protein? 07/07/2019

Currently, there are no specific drugs or compounds designed to target ARHGDIG protein. However, future research may identify potential small molecule inhibitors or activators that modulate its function.

Are there any drugs or therapeutic targets related to the ARHGDIG gene? 04/25/2019

Currently, there are no drugs or therapeutic targets specifically related to the ARHGDIG gene. However, further research on the function and regulation of ARHGDIG may provide insights into potential therapeutic strategies for diseases or conditions where dysregulation of ARHGDIG or its associated pathways is implicated.

Have any disease associations been identified for the ARHGDIG gene? 02/23/2019

Currently, there is limited information about disease associations specifically linked to the ARHGDIG gene. Further research is needed to explore if any diseases or disorders are associated with this gene.

Is the ARHGDIG gene highly conserved across different species? 01/12/2019

The ARHGDIG gene is moderately conserved across different species. It has been identified in various vertebrate species, including humans, mice, and chickens. While there may be differences in the exact sequence and structure of the gene between species, the overall function and regulation of ARHGDIG appear to be conserved.

Can genetic knockout or knockdown of ARHGDIG gene have phenotypic effects? 12/26/2018

The specific phenotypic effects resulting from the knockout or knockdown of the ARHGDIG gene are yet to be characterized. However, considering its potential role in cellular processes, it is expected that altering its expression could impact various cellular functions and potentially lead to observable phenotypic effects.

Has the ARHGDIG gene been implicated in any neurological disorders? 11/12/2018

There is currently no known association between the ARHGDIG gene and neurological disorders. Research in this area is limited, and further studies are needed to investigate any potential links between ARHGDIG and neurological conditions.

Are there any known interacting partners of ARHGDIG protein other than Rho GTPases? 10/04/2018

While Rho GTPases are the primary known interacting partners, studies suggest that ARHGDIG protein may also interact with other proteins involved in cellular signaling and cytoskeletal dynamics. However, more research is required to identify and characterize these potential interactions.

Is ARHGDIG protein involved in cellular processes other than Rho GTPase regulation? 06/02/2018

While its precise role is not well understood, studies suggest that ARHGDIG protein may play a role in other cellular processes, such as cytoskeleton organization, cell adhesion, and cell migration. However, more research is needed to confirm these findings.

Are there any known diseases or conditions associated with ARHGDIG protein? 10/15/2017

Currently, there are no specific diseases or conditions directly associated with ARHGDIG protein. However, further research is needed to fully understand its role and potential implications in various cellular processes and diseases.

Are there any known genetic mutations or polymorphisms associated with the ARHGDIG gene? 09/14/2017

Currently, there is limited information regarding specific genetic mutations or polymorphisms in the ARHGDIG gene. Further genetic studies are needed to explore this aspect.

Can ARHGDIG gene expression be influenced by epigenetic modifications? 06/30/2017

The influence of epigenetic modifications on ARHGDIG gene expression has not been extensively studied. However, it is possible that epigenetic modifications, such as DNA methylation or histone modifications, could regulate ARHGDIG expression. Further research is required to determine the specific epigenetic mechanisms involved in the regulation of ARHGDIG gene expression.

Are there any mutations in the ARHGDIG gene associated with human diseases? 11/01/2016

Currently, there is no established association between specific mutations in the ARHGDIG gene and human diseases. However, research efforts to identify potential disease-associated mutations are ongoing, and future studies may provide further insights into this aspect.

Can alterations in ARHGDIG expression or function contribute to developmental disorders? 10/19/2016

The potential contribution of altered ARHGDIG expression or function to developmental disorders is not well understood. However, since it plays a role in cellular processes such as cell migration and adhesion, which are crucial for proper development, it is possible that dysregulation of ARHGDIG may impact developmental processes. Further research is needed to explore this possibility.

Can ARHGDIG protein interact with other proteins or molecules? 06/10/2016

ARHGDIG protein is known to interact with Rho GTPases, particularly the RhoA and Cdc42 isoforms. These interactions help regulate the activity and localization of Rho GTPases within the cell.

Are there any functional studies investigating the role of ARHGDIG in specific cellular processes? 05/25/2016

Functional studies on the role of ARHGDIG in specific cellular processes are limited. However, some studies have provided insights into its involvement in cell migration, adhesion, and cytoskeletal dynamics by interacting with Rho GTPases. More detailed functional investigations are required to fully understand its contribution to these processes.

Customer Reviews (10)

Write a review
Reviews
11/17/2022

    They provide a wealth of technical information and extensive documentation about the ARHGDIG protein, ensuring I have a comprehensive understanding of its characteristics, handling protocols, and storage requirements.

    11/03/2022

      The manufacturer's commitment to customer support and collaboration greatly enhances the overall research experience.

      06/08/2022

        With expert assistance and reliable product quality, researchers can conduct their experiments with confidence, enabling them to contribute to advancements in the field and potentially improve future therapeutic interventions.

        01/06/2021

          by utilizing ARHGDIG protein in trials and collaborating with a supportive manufacturer, researchers can gain access to a versatile tool that can aid in their understanding of angiogenesis and vascular biology.

          09/12/2019

            Whether I need assistance in experimental design, troubleshooting, or data interpretation, they provide prompt and personalized support, ensuring that my research progresses smoothly and efficiently.

            02/20/2019

              This includes rigorous quality control measures to ensure the consistency and purity of the protein, thereby reducing variability in the experimental outcomes.

              12/15/2018

                the manufacturer ensures a streamlined supply chain management system to meet my trial's requirements.

                03/14/2018

                  This proactive approach not only aids in expanding my knowledge but also encourages continuous improvement and innovation in my experimental approach.

                  07/25/2017

                    they can provide fast and efficient delivery services, minimizing any potential delays and allowing researchers to proceed with their studies in a timely manner.

                    05/18/2017

                      Their comprehensive knowledge about ARHGDIG protein and its applications can assist researchers in optimizing protocols and ensuring reliable results.

                      Ask a Question for All ARHGDIG Products

                      Required fields are marked with *

                      My Review for All ARHGDIG Products

                      Required fields are marked with *

                      0

                      Inquiry Basket

                      cartIcon
                      logo

                      FOLLOW US

                      Terms and Conditions        Privacy Policy

                      Copyright © 2024 Creative BioMart. All Rights Reserved.

                      Contact Us

                      • /

                      Stay Updated on the Latest Bioscience Trends