Recombinant Human ARHGDIG
Cat.No. : | ARHGDIG-26234TH |
Product Overview : | Recombinant full length Human ARHGDIG with N-terminal proprietary tag. Predicted MW 50.86 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843). |
Protein length : | 225 amino acids |
Molecular Weight : | 50.860kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Primarily expressed in pancreas and brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEV LDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPL PPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRV DKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD |
Sequence Similarities : | Belongs to the Rho GDI family. |
Gene Name : | ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ] |
Official Symbol : | ARHGDIG |
Synonyms : | ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3; |
Gene ID : | 398 |
mRNA Refseq : | NM_001176 |
Protein Refseq : | NP_001167 |
MIM : | 602844 |
Uniprot ID : | Q99819 |
Chromosome Location : | 16p13.3 |
Pathway : | G13 Signaling Pathway, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem; |
Function : | GTPase activator activity; Rho GDP-dissociation inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
ARHGDIG-2495H | Recombinant Human ARHGDIG Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIG-617H | Recombinant Human ARHGDIG | +Inquiry |
ARHGDIG-9830H | Recombinant Human ARHGDIG, His-tagged | +Inquiry |
ARHGDIG-776H | Recombinant Human ARHGDIG protein, GST-tagged | +Inquiry |
ARHGDIG-11376Z | Recombinant Zebrafish ARHGDIG | +Inquiry |
◆ Lysates | ||
ARHGDIG-115HCL | Recombinant Human ARHGDIG cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (33)
Ask a questionCurrently, there are limited functional studies investigating the downstream effects of ARHGDIG on cellular signaling pathways. Future research is needed to elucidate the specific signaling pathways influenced by ARHGDIG and how it modulates cellular responses.
The alteration of ARHGDIG gene expression in pathological conditions has not been extensively studied. However, some studies have reported differential expression levels in specific disease contexts, suggesting a potential association with certain pathological conditions. Further research is needed to fully understand the expression patterns and potential implications of ARHGDIG in various diseases.
The exact downstream signaling pathways regulated by ARHGDIG protein are not yet fully elucidated. However, since it interacts with Rho GTPases, which are involved in numerous cellular processes, it is likely that ARHGDIG protein influences various downstream signaling pathways related to cell migration, adhesion, and cytoskeletal dynamics.
There is limited information available regarding isoforms or splice variants of ARHGDIG protein. Further research is needed to determine if any exist and if they contribute to functional diversity.
As of now, there is limited evidence suggesting the involvement of ARHGDIG in cancer development or progression. However, future studies exploring its expression and function in various cancer types may shed light on its potential role in oncogenesis or tumor progression.
Presently, there is limited information regarding post-translational modifications of ARHGDIG protein. Future studies focusing on protein modifications such as phosphorylation, acetylation, or ubiquitination may provide insights into its regulation and functions.
The impact of environmental factors or stimuli on ARHGDIG gene expression has not been extensively investigated. However, it is plausible that certain environmental cues or stimuli could modulate its expression, considering the potential involvement of ARHGDIG in cellular responses to extracellular signals.
The therapeutic potential of targeting ARHGDIG protein is uncertain due to limited knowledge about its function and involvement in diseases. Further research is essential to determine if it can be a viable therapeutic target for specific conditions.
The potential involvement of ARHGDIG protein dysregulation in diseases is currently unknown. However, aberrant regulation of proteins involved in Rho GTPase signaling, such as ARHGDIG, has been implicated in various diseases. Further investigations are required to determine if ARHGDIG dysregulation contributes to specific disease processes.
ARHGDIG protein is conserved across various species, including humans, mice, and other mammals. This suggests that it likely plays a fundamental role in cellular processes.
As of now, limited research has been conducted on ARHGDIG protein. However, ongoing studies are likely exploring its function, interactions, and potential roles in cellular processes and disease pathways.
The tissue-specific expression pattern of the ARHGDIG gene has not been extensively studied. However, some studies have reported differential expression levels in various tissues, suggesting a potential tissue-specific regulation. Further research is needed to fully understand the tissue-specific expression of ARHGDIG and its potential implications.
The regulatory mechanisms of ARHGDIG gene expression are not well understood, and specific transcription factors that directly regulate its expression have not been identified. Further studies investigating the transcriptional regulation of the ARHGDIG gene are needed to delineate the underlying mechanisms.
Currently, there are no specific animal models available for studying the function of the ARHGDIG gene. Developing animal models, such as knockout or knockdown mice, may be useful in investigating the physiological roles of ARHGDIG and its potential implications in disease.
The exact role of the ARHGDIG gene in immune response or inflammation is not well understood. However, since Rho GTPases, which are regulated by ARHGDIG, play important roles in immune cell function and inflammation, it is possible that ARHGDIG may indirectly influence immune response or inflammation through its regulation of Rho GTPases.
At present, there is no evidence to suggest that ARHGDIG protein can be used as a biomarker for any specific diseases. Further studies are necessary to explore its potential as a diagnostic or prognostic biomarker in different pathological conditions.
ARHGDIG protein is primarily localized in the cytoplasm, where it interacts with Rho GTPases to regulate their activity and localization. However, it's possible that the protein may have additional subcellular localizations that are yet to be discovered.
The expression of ARHGDIG protein may vary in different tissues and cell types. Some studies have shown differential expression levels in specific tissues, indicating potential tissue specificity in its function.
Currently, there are no specific drugs or compounds designed to target ARHGDIG protein. However, future research may identify potential small molecule inhibitors or activators that modulate its function.
Currently, there are no drugs or therapeutic targets specifically related to the ARHGDIG gene. However, further research on the function and regulation of ARHGDIG may provide insights into potential therapeutic strategies for diseases or conditions where dysregulation of ARHGDIG or its associated pathways is implicated.
Currently, there is limited information about disease associations specifically linked to the ARHGDIG gene. Further research is needed to explore if any diseases or disorders are associated with this gene.
The ARHGDIG gene is moderately conserved across different species. It has been identified in various vertebrate species, including humans, mice, and chickens. While there may be differences in the exact sequence and structure of the gene between species, the overall function and regulation of ARHGDIG appear to be conserved.
The specific phenotypic effects resulting from the knockout or knockdown of the ARHGDIG gene are yet to be characterized. However, considering its potential role in cellular processes, it is expected that altering its expression could impact various cellular functions and potentially lead to observable phenotypic effects.
There is currently no known association between the ARHGDIG gene and neurological disorders. Research in this area is limited, and further studies are needed to investigate any potential links between ARHGDIG and neurological conditions.
While Rho GTPases are the primary known interacting partners, studies suggest that ARHGDIG protein may also interact with other proteins involved in cellular signaling and cytoskeletal dynamics. However, more research is required to identify and characterize these potential interactions.
While its precise role is not well understood, studies suggest that ARHGDIG protein may play a role in other cellular processes, such as cytoskeleton organization, cell adhesion, and cell migration. However, more research is needed to confirm these findings.
Currently, there are no specific diseases or conditions directly associated with ARHGDIG protein. However, further research is needed to fully understand its role and potential implications in various cellular processes and diseases.
Currently, there is limited information regarding specific genetic mutations or polymorphisms in the ARHGDIG gene. Further genetic studies are needed to explore this aspect.
The influence of epigenetic modifications on ARHGDIG gene expression has not been extensively studied. However, it is possible that epigenetic modifications, such as DNA methylation or histone modifications, could regulate ARHGDIG expression. Further research is required to determine the specific epigenetic mechanisms involved in the regulation of ARHGDIG gene expression.
Currently, there is no established association between specific mutations in the ARHGDIG gene and human diseases. However, research efforts to identify potential disease-associated mutations are ongoing, and future studies may provide further insights into this aspect.
The potential contribution of altered ARHGDIG expression or function to developmental disorders is not well understood. However, since it plays a role in cellular processes such as cell migration and adhesion, which are crucial for proper development, it is possible that dysregulation of ARHGDIG may impact developmental processes. Further research is needed to explore this possibility.
ARHGDIG protein is known to interact with Rho GTPases, particularly the RhoA and Cdc42 isoforms. These interactions help regulate the activity and localization of Rho GTPases within the cell.
Functional studies on the role of ARHGDIG in specific cellular processes are limited. However, some studies have provided insights into its involvement in cell migration, adhesion, and cytoskeletal dynamics by interacting with Rho GTPases. More detailed functional investigations are required to fully understand its contribution to these processes.
Customer Reviews (10)
Write a reviewThey provide a wealth of technical information and extensive documentation about the ARHGDIG protein, ensuring I have a comprehensive understanding of its characteristics, handling protocols, and storage requirements.
The manufacturer's commitment to customer support and collaboration greatly enhances the overall research experience.
With expert assistance and reliable product quality, researchers can conduct their experiments with confidence, enabling them to contribute to advancements in the field and potentially improve future therapeutic interventions.
by utilizing ARHGDIG protein in trials and collaborating with a supportive manufacturer, researchers can gain access to a versatile tool that can aid in their understanding of angiogenesis and vascular biology.
Whether I need assistance in experimental design, troubleshooting, or data interpretation, they provide prompt and personalized support, ensuring that my research progresses smoothly and efficiently.
This includes rigorous quality control measures to ensure the consistency and purity of the protein, thereby reducing variability in the experimental outcomes.
the manufacturer ensures a streamlined supply chain management system to meet my trial's requirements.
This proactive approach not only aids in expanding my knowledge but also encourages continuous improvement and innovation in my experimental approach.
they can provide fast and efficient delivery services, minimizing any potential delays and allowing researchers to proceed with their studies in a timely manner.
Their comprehensive knowledge about ARHGDIG protein and its applications can assist researchers in optimizing protocols and ensuring reliable results.
Ask a Question for All ARHGDIG Products
Required fields are marked with *
My Review for All ARHGDIG Products
Required fields are marked with *
Inquiry Basket