Recombinant Human ARR3

• Cat.No.: ARR3-26077TH
• Product Overview: Recombinant full length Human Arrestin C isoform 2 with N terminal proprietary tag; Predicted MWt 65.56 kDa.

Specification

• Description: Arrestin-C also known as retinal cone arrestin-3 is a protein that in humans is encoded by the ARR3 gene.
• Protein length: 359 amino acids
• Molecular Weight: 65.560kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Inner and outer segments, and the inner plexiform regions of the retina.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVD PEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTL QVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDY VRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWM DREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQ KRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKV RVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAAR
• Sequence Similarities: Belongs to the arrestin family.

Gene Information

• Gene Name: ARR3 arrestin 3, retinal (X-arrestin) [ Homo sapiens ]
• Official Symbol: ARR3
• Synonyms: ARR3; arrestin 3, retinal (X-arrestin); arrestin-C; arrestin 4; ARRX
• Gene ID: 407
• mRNA Refseq: NM_004312
• Protein Refseq: NP_004303
• MIM: 301770
• Uniprot ID: P36575
• Chromosome Location: Xq
• Pathway: CXCR4-mediated signaling events, organism-specific biosystem; Thromboxane A2 receptor signaling, organism-specific biosystem; Visual signal transduction: Cones, organism-specific biosystem
• Function: opsin binding; phosphoprotein binding; protein binding; protein domain specific binding

Reviews

12/21/2020

The ARR3 protein is renowned for its exceptional quality and reliability, making it an ideal choice to fulfill my experimental requirements.

08/24/2020

With the ARR3 protein's high-quality composition and reliability, researchers can confidently proceed with their studies, knowing that they have access to a protein that consistently delivers accurate results.

07/19/2018

With its high purity and stability, this protein ensures dependable and accurate results, which are crucial for the success of my research endeavors.

Q&As

Does ARR3 have any other functions outside of cone cells?

While ARR3 is primarily expressed in cone cells, studies have suggested that it may have additional roles in non-visual tissues. These include modulating GPCR signaling in other cell types, such as neurons and immune cells, and potentially contributing to cellular processes like synaptic transmission and immune response regulation.

Can ARR3 be used as a biomarker for certain eye diseases?

There is ongoing research exploring the potential use of ARR3 as a biomarker for certain eye diseases. Changes in the expression or localization of ARR3 have been observed in conditions like age-related macular degeneration (AMD) and retinitis pigmentosa (RP), suggesting its potential as a diagnostic or prognostic indicator in these diseases.

How is ARR3 different from other arrestin proteins?

ARR3 is a subtype of arrestin proteins that is specifically expressed in cone cells of the retina. It differs from other arrestin proteins, such as ARR1 (also known as arrestin-1), which is expressed in rod cells and plays a similar role in the desensitization of rod photoreceptors.

How is ARR3 regulated in cone cells?

The expression and activity of ARR3 are tightly regulated to ensure proper visual function. Several factors, including light exposure, intracellular calcium levels, and protein kinases, can impact ARR3's localization, binding affinity, and activity, ultimately modulating its efficiency in desensitizing cone opsins.

Are there any diseases associated with ARR3 mutations or dysregulation?

Mutations or dysregulation of ARR3 have been linked to certain visual disorders, such as cone dystrophy and night blindness. These conditions are characterized by impaired cone cell function and visual impairment, underscoring the importance of ARR3 in maintaining normal cone cell physiology.

How does ARR3 contribute to vision?

By binding to cone opsins, ARR3 helps to reset the signaling cascade after absorption of light, allowing the cones to respond to subsequent visual stimuli. This process is crucial for maintaining proper visual sensitivity and preventing adaptation or saturation of the photoreceptor cells.